KEGG   Alligator mississippiensis (American alligator): 102571581Help
Entry
102571581         CDS       T03087                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102571581 (HDAC6)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102571581 (HDAC6)
Messenger RNA biogenesis [BR:amj03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102571581 (HDAC6)
Membrane trafficking [BR:amj04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102571581 (HDAC6)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102571581 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 833 aa AA seqDB search
MDGYCLFNHVAIAARHARERRGLQRVLIVDWDVHHGQGTQFIFEDDPSVLYFSVHRYDNG
AFWPHLPDSDSSAVGRGQGCGFTINLPWNQPGMTDADYISAFLQLLLPVAFEFQPQLVLV
AAGFDAAIGDPKGQMLVSPACFAHLTHMLLALAGGKVVLALEGGYNLHSLTEGVSAALGS
LLGDPCPPLAGPAAPCPSALQSISKALGIHAQFWPSLQRVEVSVLSTEDEGVEEALGETG
GVPSPVELPCPEALPFLEAPPPRRPPACTGLVYDERMTQHYNMWDSQHPERPQRVTRALS
RLQELGLEPRCLRLPPRLATEPELLLCHSPEYVAGLRATVGLRPRELHRAGSRYNSVYMC
GESFEAACLAAGCVLSAVDAVLAGQVQNAVAVVRPPGHHAEPDAACGFCLFNSVALAARY
AQQVAGRPLRVLILDWDIHHGNGIQHIFEEDPSVLYISLHRYDAGAFFPGGPAGGAGQVG
RGQGRGYTLNVPWEEPRAGDPEYLPALLRLCLPVAYQFRPELVLVAAGFDAAQGDPLGGC
LVTPQGYGTMAWLLATLACGRLILALEGGYNLAATAESLATCVRALLGDPPLAPPPVLAL
PLSPHPQPSALRALGLASAVHRTYWACLRLHVPSMDCDASEDRSQAPQEALPSDDLSSLG
SLSLEDRSQEGLGSPDSVPVGWTRRKMKTEPELEGVGINPEGEEAPPEGAGLAAPDLPED
ALYAVTPLSWCPHLSSVAPVPPAGLDILAPCQKCGCQGENWVCLTCYQVLCSRYVAGHMV
AHGDASGHPMVLSFADLSAWCYDCEAYIHHPTLLPAKILAHRLKFGNELPALL
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggatggctactgcctcttcaaccatgtggccatcgctgcccgtcatgcccgggagcgc
cgtggattgcagcgggtcctgattgttgactgggatgtccaccatgggcagggaacccag
ttcatctttgaagatgaccccagcgtcctgtacttctcggtccatcgctatgacaacggg
gcattctggccccatctcccggattctgattcatcggctgtggggcgggggcaaggctgt
ggcttcaccatcaacctgccctggaaccagcctggcatgacggatgctgactacatctcc
gccttcctccagctcctgctgcctgtagccttcgagttccagccccagctggttcttgtg
gctgctggctttgatgctgccattggggaccccaaggggcaaatgttggtgtcacctgcc
tgcttcgcccacctcacccacatgctgctggcgctggctggggggaaggttgtgctggcc
ttggagggcggctacaacctccactctctcactgagggggtcagtgctgccctggggtct
ctcctgggagacccctgccccccactggccgggccagctgccccctgtcccagcgctctc
cagtccatctcaaaggctctgggtattcatgcccaattctggccatctcttcagcgtgtt
gaggtctcggtactttccacagaggatgagggagtagaggaggcactaggggagacaggg
ggggtcccatccccagtggagctgccctgcccagaggctctgcctttcttggaggcccca
cccccccgccgcccccctgcctgtaccggcttggtctatgatgaacgcatgacccagcac
tacaacatgtgggacagccagcacccagagcggccacagcgggtgacccgggccctgagc
cggctgcaggagttggggctggagccacggtgcctgcgcctgcctccccgtctggctact
gagcccgagctgttgctgtgccacagcccagagtacgtggccggactccgggccacagtt
gggctgcgcccgcgggagctacatcgtgctggttcccgctacaactcggtctacatgtgc
ggggagtcctttgaggctgcatgcctggcagctggctgtgtccttagcgctgtggatgcc
gtgctggctgggcaggtgcaaaatgcagtggccgtggtgcggcccccagggcatcacgca
gagcctgatgctgcctgtggcttctgcctcttcaattcagtggccctggcagcccgctat
gcccagcaggtggctggccggcccttgcgggttctgattctggactgggatattcaccat
ggcaatggaatccagcatatttttgaggaagaccccagtgtgctgtacatctccctgcac
cgctatgatgctggcgccttctttccaggggggccagcgggaggagcagggcaggtgggg
cgggggcaggggcggggctacacccttaatgtgccgtgggaggagcctcgtgctggggac
ccggaatacctgcctgccctgctgcgcctctgcctgcctgtcgcctaccagttcaggccg
gagctggtgctggtggcagctgggttcgatgcggcacaaggcgatcccctgggcggctgc
ctggtgaccccccagggctacggcaccatggcctggctgctggctacgctggcctgtggc
cgccttatcctggcccttgagggtggctacaacctggcagcaacagcagagtccctggcc
acatgcgtccgggcactgctgggagaccccccactggccccacctccagtcttggcacta
cccctgtctccacacccccagcccagtgctctccgtgccctcggcctggccagcgctgtg
caccgtacctactgggcctgcctgcgtctccatgtgccctccatggactgtgatgcctct
gaggacagaagccaagccccccaggaggccctgccttccgatgacctctcctccctgggt
tccctctccctggaggacaggtcccaggaggggttgggcagcccagactctgtccctgtg
ggctggaccaggaggaagatgaaaacagagcctgagttggaaggggtggggattaaccca
gaaggggaggaagctcctccagaaggggcagggcttgcagccccagatttaccagaggat
gcactctatgctgtgacaccgctgtcctggtgcccccacttgagctctgtagcaccagtg
cccccagccgggctggacatcctggcaccgtgccagaagtgtgggtgccagggtgagaac
tgggtctgcctcacctgctaccaggtgttgtgcagccgctatgtggcaggtcacatggtt
gcccatggtgatgcttctggccaccccatggtcctgagtttcgcagacctctctgcctgg
tgctatgactgtgaggcctatatccatcacccaacccttttgccagccaagatcttggct
catcgtctcaagttcggtaatgagctgcctgcactactttga

DBGET integrated database retrieval system