KEGG   Alligator mississippiensis (American alligator): 102575637Help
Entry
102575637         CDS       T03087                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102575637 (SETDB1)
Enzymes [BR:amj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102575637 (SETDB1)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102575637 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102575637 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 1347 aa AA seqDB search
MRAGAAEVFPPESACVVLSPAFAAASRGEVWSARATVAGSGVGAPQCSALERSPALASRV
AGSEMDSQEIGELQQEVMEELGISMEDLQQFIDEELEKLECVKQRKKQLEELEKNVKQKE
AEVAHVDQLFDDASRAINKCEVLVKDLYSKLGLQYRESSSEDEDSASKPTEVIEIPDEDD
DDVMSVDSGDTSKNPKDQTLLREAMAAMRKSAQDVQKFMDAITKKKTTQETQRDGVSSQQ
SSVNASQQANSGGDLSKDGDLTVGMRILGKKRTKTWHKGTLIAIQSVGESRRPGGAGKKY
KVKFDNKGKSLLSGNHIAYDYHPLPEKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNK
LRFLIFFDDGYASYVTQPELYLVCRPLKKTWEDIEDVSCRDFIEEYITAYPNRPMVLLKS
GQLIKTEWEGTWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQE
KKQSGQARTRPNVGAVRSKGPVVQYTQDLTGTGTQYKPIEQMQATVLGSQPVSPQPAEIE
GSDSQLAQSRKQVAKKSTSFRPGSVGSGQSSPASPVLSETPPIGRTGVNQQVYRFPSTSL
PSQPISGVAPSFHGIMDRVPNEPSYHAPMEKLFYLPHVCSFTCLSRVRPIRSDQYRSKNP
LLIPLLYDFRRMTARRRINRKMGFHVLYKTPCGLCLRTMQEIERYLFETDCDFLFLEMFC
LDPYVLVDRKFQPYKPFYYIADITKGKEDVPLSCVNEIDSTPPPQVAYSKERIPGKGVYI
NTSWEFLVGCDCKDGCRDKSKCACHQLTVQATGCTPGGQINHNSGYQYKRLDECLPTGVY
ECNKRCKCNVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTD
DFADKEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDDDDDNTGSEEQE
ESNEDSSDDNFGKDEDFSTNSVWRSYATRRQTRGQKENGLSETASKDSGLARQVSHEESA
VAVSCKLPVSEETSKNKVASWLNSNSMTDSFQDNDSASSFKMNEAGEAKAGKMDAPGERE
RASTSGLGGLDAEGKGQKKEESEETNKFPLLSETTGRLYGYNPSPPKLEGVRRPLSKTTL
HQSRRQSAPPQPSTDDVLTLSSSTDSEGENGQTASGQAQGNANDSDDIQTISSGSEEEDD
KKNPSSGLGPVKRQVAVKSTRGFALKSTHGIAIKSTNLASADKGESAPVRRTTRQFYDGE
ESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWD
YNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 4044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctggcgccgcggaggtatttccgcccgagagtgcctgtgtagtgctgtcccct
gctttcgcggccgcctctcgaggggaggtttggtccgctcgggccaccgtcgccggaagt
ggtgtcggggcccctcagtgcagcgccctggaaaggagcccggccctcgccagccgcgtt
gcagggagcgaaatggattcccaggagattggagagctgcagcaggaagtgatggaggag
ctgggcatctccatggaagatctccagcagttcattgacgaggagctggagaaactcgag
tgcgtgaagcaacgaaagaagcagctggaagagctggaaaagaacgttaagcagaaagag
gcagaagtagctcacgtggaccagctctttgatgacgcctcaagagccatcaataaatgt
gaggtgctggtaaaagatctctactccaagctagggcttcagtatcgtgagagcagctct
gaagatgaggactcggcttccaagcccacggaagtgattgaaattccagacgaggatgat
gatgatgtcatgagcgtggattcaggtgatacaagtaaaaacccgaaggatcagactctg
cttcgagaagccatggccgcgatgaggaaatctgcccaggatgttcagaaattcatggat
gccattaccaaaaaaaaaaccacccaggaaacgcagagagatggggtttcctctcagcag
agctcagtaaatgcatcccagcaagcaaactctgggggcgatctcagcaaggatggtgat
ctcacagttggcatgcgcatcctgggcaagaaaaggaccaagacatggcacaagggaacc
ctgattgcaatccaatcagtgggcgagtcccgccgccctgggggtgctggcaagaagtat
aaagtgaagtttgacaacaaagggaagagtttgctttctggcaatcacattgcttatgac
tatcacccccttcccgagaagctgtatgttggaagccgggtcgtggccaaatataaggat
ggaaatcaagtctggttgtatgctggcatcgtggctgaaactcccaatgtgaagaacaaa
ttgaggtttcttatcttctttgatgacggctatgcttcctacgtcacccagccagagctg
tacctggtctgcaggccgttgaagaagacctgggaagatattgaggacgtttcctgccgg
gatttcattgaggagtacatcacggcctaccccaaccgccccatggttctgctgaagagc
ggccagctgattaaaacagagtgggaagggacatggtggaaatccagagtggaggaagtg
gatggcagcttggtcaaaatcctcttcttggatgacaagcgctgcgagtggatttaccgc
ggctccacacgcctcgaacccatgttcagcatgaaaacctccacagcctccactcaggaa
aagaagcagagcgggcaggcgaggacgcggcccaatgtcggtgctgtgcggagtaagggg
cctgttgtacaatacacccaagacctgacaggaaccggcactcagtataagcccatagaa
cagatgcaggcgacagtgttgggctctcagcctgtttctccacagcctgctgagattgaa
ggctctgacagtcagctggctcaatctaggaagcaagtggccaaaaaaagcacttccttc
cgtcctggctcggtggggtccgggcagtcatctcctgcttctcctgtcttaagcgagact
ccccccattggaagaaccggagtgaaccagcaagtctaccggttcccaagcacatctctt
ccgtcgcagccaatcagcggggtggcaccatcattccatggcataatggaccgggtgccc
aacgagccctcgtaccatgcccccatggagaagctcttctacctgccccatgtgtgcagc
ttcacctgcttgtcgcgtgtccgccccatccgcagtgaccagtaccgcagcaagaaccct
ctgctcatcccacttctctatgacttccggcgcatgacggcccggcgccgcatcaaccgc
aagatgggctttcacgtcttgtacaagacaccgtgtgggctctgcctccgcaccatgcaa
gagattgagcgctacctgtttgagacagactgtgacttcctcttcctggagatgttttgc
ctggacccttacgtgctggtggaccgcaagttccagccctacaagcctttctactacatt
gctgacatcaccaagggcaaggaggacgtgcccctgtcctgtgtcaatgagatagacagc
acaccacccccacaggtggcttacagcaaggaacgcatccctgggaagggtgtctatatc
aacaccagctgggagttccttgtcggctgcgactgcaaagatggctgcagggacaaatcc
aaatgtgcctgtcaccagctgacagtccaagcgacaggctgcactcctggtgggcaaatc
aatcataattcaggctaccagtacaagcggctggacgaatgcctccccacaggggtctat
gagtgcaacaagagatgcaaatgcaacgtcaacatgtgcaccaaccgcctggtgcagcat
gggctccaggtccggctccagctcttcaagacacagaacaaaggctgggggatccgctgc
ctggatgacattgctaagggctcttttgtctgcatctacgcagggaaaatcctgacagat
gacttcgctgacaaggaagggctggagatgggtgatgagtactttgccaacctggaccac
attgagagcgtggagaactttaaggagggctatgagagcgatgccaaatgctcttctgac
agcagcggcgtggacctgaaggatgatgatgatgacaacacgggctcagaggagcaggag
gagtccaacgaagacagctctgatgacaactttggcaaggacgaagacttcagcaccaac
tcggtgtggcgcagctatgccactcgccgccagacccgaggacagaaggagaatggcctc
tcagagacagcttccaaggactcgggccttgcccggcaggtgagtcacgaggagagcgcc
gtggcagtctcctgtaagctgcccgtgtccgaagagacctccaagaacaaagtggcttcg
tggctgaactccaacagtatgactgacagcttccaggacaacgacagcgcatcctccttc
aagatgaacgaggctggggaggcaaaggccggcaagatggatgccccaggcgaaagggag
cgagcttccacctcagggcttgggggcttggatgcagaagggaagggacagaagaaggag
gaatcagaagaaacaaacaagttcccactgctgagcgagacgacaggcaggctgtacggc
tataaccccagcccaccgaagctggagggtgtccgcaggcccctgagcaagaccaccctg
catcagagcaggcggcagtcggcccccccgcagccctccactgacgacgtattgacgctc
tccagcagcactgacagtgagggggagaatgggcagacagcctcgggacaagcacaaggc
aatgccaatgacagcgatgacatccagaccatctcctccggctcggaggaagaagacgat
aaaaagaacccctcttctggcctcggtcctgtgaagagacaagtggcagtgaagtctacc
aggggctttgccctcaagtcaacacatggcattgctataaagtcaaccaaccttgcatcg
gctgacaagggtgagagtgcgccggtgcgaaggaccacccgccagttctatgacggggag
gaatcctgctacatcattgatgctaagcttgaaggaaacctcggccgctaccttaaccat
agctgtagccctaacctgtttgtgcagaacgtctttgtggacacccacgatctccgcttc
ccctgggtcgccttcttcgccagcaagaggatacgagctggcacggagctgacatgggac
tacaactacgaggtgggcagcgtggagggcaaggagcttctgtgctgctgcggggctatc
gaatgccgaggccggttgctgtga

DBGET integrated database retrieval system