KEGG   Alligator mississippiensis (American alligator): 102576351Help
Entry
102576351         CDS       T03087                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102576351 (SETDB2)
Enzymes [BR:amj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102576351 (SETDB2)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102576351 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102576351 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1148 aa AA seqDB search
MHDTCVQLLQRMEQTKSDLQTVWREMEDERVDFIFEQMQNLLLSLKQKIKDGSATSKECF
QACMLLKEANLSNLFTSTNVNNVTDEDTMQKSESRLQPSESNGNRTDTEDSSLFPKTEAQ
KVERSMKTHLPFCAGLSRIVNMEEKEKSCSENEEAANEIVELPLTLPYQNHNCSNACLSN
RPLNSYKSENPLKIPILCQFQRRHAKADCLSKSHDVNYKAPCGKSLRNFEEVQNYLLETE
CDFLSVDYFSFNTYVQLGRNTVNQEPLVFDFDISNGAEVVPISFCNDIDRTRLPFFKYRK
ASWPRGYYLNNFSSTFVDSCDCTDGCTDRLKCACLQLTARGFSESSMSPNKVLCGYKHKR
LEMPITSGIYECNVSCRCNRMLCQNRVVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFV
CTYSGRLMSRAESQETGDANHEDNEQDAESGRSHSSLPKKRRGDAACSDSEIELVQTGKG
ALHAEYEPLTQPLDAENKPPDLLPSLYRLQNNGCNPNNLINSGVRRPKARIDFLHNHQPE
LGVDTLAHDATSDEGSSLSQQSTKLKPTTGTKRRKGKLNLRQELEDLEETMQVESAVSLG
AKCKERTSPQDLAHGKLVTQGDAYAVKKDRALLHKSEFKEEKCKSSKQDPFCHETLLKNS
DQENIYLLDATKEGNVGRFLNHSCCPNLFVQSVFVETHNKNFPWVAFFTNRHVKSGTELT
WDYGYEAGSMPETEIPCQCGVQKCRKKILSPPPLGHAHFRVLAPLSRCLGAAVGSPVSCL
YGSAGSEWFRPPRNSLQDPVCADVTSLAKNVLRYTCQLLLQWLITKLCWIQVEKWLALEM
LVTSQIMAKMVRRRCAFCPEGEECSIMYISEEQNLAVHQDCLLYSSGFVESEEYNPDNLD
IRFDVASVLNEIKRGKRLMCNFCRKKGATVGCEERACRRSYHYFCALCDDAAIETDEVKG
IYRVFCPKHDPGNRNNHYGKVSSQTTALDSTVWGGDAVSRRRRQSMISSTIREAMSTEET
AEENSLRVLRNNNRHKVRIDFLRKCKRAGLLDDIFEAMLDTLHLAQEKLMDDNTSETEYE
ETVTSLFECGLFENILTNAHSGTEEKIQELLETRKRLDTQIELLQELKEEVVLPVQENRA
SASSSVSE
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatacgtgtgtacaactactccaaaggatggaacaaactaaaagtgacttacag
acggtttggagggagatggaagatgaaagagtggactttatatttgagcagatgcaaaac
ctgttgctgtctctgaaacaaaagatcaaagatggaagtgcaacaagcaaagagtgcttc
caagcttgcatgctgttgaaagaggctaatctaagtaatcttttcacatcaacaaatgta
aacaatgtgactgatgaagataccatgcagaaaagcgaatctagattacagccttctgaa
tcaaatggaaatagaacagatacagaagacagttctctcttccctaagactgaggcacag
aaagtggagaggagcatgaagacacacctacctttttgtgcagggttgagtagaattgtg
aacatggaagagaaggaaaagtcatgttcagagaatgaagaggcagctaatgaaatcgtg
gagttacctttaacattgccttatcagaatcacaattgctctaatgcgtgtctttccaat
agaccactgaactcctacaagagtgaaaacccccttaagataccaatcctgtgtcagttc
caaagacgacatgcaaaagcagactgtctttccaagtcacatgatgtgaattataaagcc
ccctgtgggaagagtctgagaaattttgaagaggtgcagaattacctgcttgaaacagag
tgtgacttcttatctgttgattacttttccttcaacacatatgtacagctgggcaggaac
actgtaaaccaagaaccacttgtatttgattttgatatcagcaatggagctgaggtggtg
cccatttccttctgcaatgacattgaccgtacaagattacctttctttaaatacagaaag
gcatcatggccacgtggatactatctgaacaacttttccagcacgtttgttgattcatgc
gactgtacagatggctgcacagataggttaaaatgtgcatgcctacagctgactgcaaga
ggctttagtgaaagttccatgtcgccaaataaagtactttgtggatataagcataaaaga
ctggagatgcccattactagtggaatttacgaatgtaacgtatcatgcaggtgtaaccga
atgttgtgtcagaacagagtagtacagcatggcatccaggttcggttacaagtgtttaac
acagaaaagaaaggctggggagtccgctgccttgatgatattgacaaaggaacatttgtt
tgcacttactcaggcaggctgatgagcagagctgaatctcaggaaacaggtgatgctaat
catgaggataatgaacaagatgccgagagtggcagaagtcacagctcacttccaaagaaa
agaagaggggatgctgcttgttcagattctgagattgagcttgtgcagactggtaaaggt
gctcttcatgcggagtatgaacctttgactcaacctttagatgctgaaaacaaaccacct
gatcttttgccatctctgtacagacttcagaataatggatgtaatccaaataatttgatc
aactctggtgttagaagacctaaagccagaatagattttctccacaatcaccagccagaa
ctgggagttgatacactggcacatgatgccacctcggatgaaggtagctctttatcccag
cagtcaaccaaattgaaaccaaccactggaaccaagagaagaaaaggaaaactaaacctg
cgacaggagctagaggatctggaggagaccatgcaggttgaatctgctgtcagccttggt
gcaaagtgcaaagagaggacatctccacaggatcttgcacatggtaaattggtcacgcaa
ggtgatgcttatgctgtgaaaaaggacagggctctactccataagagtgagttcaaagaa
gaaaaatgtaagagctccaaacaagatcctttttgtcatgagacgcttctgaagaattct
gatcaagaaaacatttatttgttggatgccacaaaagaaggaaatgtgggtcgatttctt
aatcatagctgctgcccaaatctctttgtgcaaagtgtctttgtagagactcacaacaag
aatttcccctgggtggcattcttcacaaacaggcacgtgaaaagtggaactgaactcacg
tgggattatggttatgaagctggaagcatgccagagactgagatcccctgtcagtgtggc
gttcagaagtgcaggaaaaaaattttatctccgcccccacttgggcacgcccacttccgt
gtcctcgcgcccctttctcgctgcttgggagcggcggttggtagtcccgtgtcctgtctg
tacggaagcgcggggagcgaatggtttcgtccgccccgcaatagcctccaggatccagtg
tgcgctgatgtgacatctctagcaaagaacgtattacggtacacctgccaattgctgcta
cagtggctgatcacaaagctttgttggatacaggtggaaaagtggctagctctggaaatg
ctggttacttcccagataatggcgaagatggtaagaagaaggtgtgcattttgtcccgag
ggtgaggaatgttctataatgtacatctcggaggagcaaaaccttgcagttcatcaagac
tgtttgctatattcctcaggatttgtggaatctgaagagtacaacccagataatcttgat
ataaggtttgatgtagcttcagtgttgaatgaaatcaagagaggaaagcggctgatgtgc
aacttctgtcgcaaaaaaggagctactgtaggctgtgaggaaagagcctgtcgccgaagt
taccactacttttgtgcactgtgcgatgatgcagcaatagaaactgatgaagtaaaagga
atttaccgggtgttctgtccaaaacatgacccaggcaataggaacaatcactatggaaag
gtcagctcccagactactgcactggacagcacagtttggggaggagatgcagtcagtagg
aggagaaggcagtcaatgatatcttccaccatcagggaagcaatgagcacagaggaaaca
gcagaagagaatagtttacgagttctaaggaacaataacagacacaaagtaagaatagat
tttcttcggaagtgcaagcgggccgggcttctggatgatatattcgaagcaatgcttgac
acacttcaccttgcacaggaaaaactcatggatgataacacttcagaaacagagtatgag
gaaactgtaacatcactttttgaatgtggcctgtttgaaaacatacttacaaatgctcat
tcagggacagaggaaaagattcaggaacttcttgaaaccaggaaaaggctggatactcag
attgaactgctgcaagagttaaaagaagaagtagttcttcctgttcaggaaaacagagcc
agtgcatctagttcagtgtctgaatag

DBGET integrated database retrieval system