KEGG   Ailuropoda melanoleuca (giant panda): 100472103Help
Entry
100472103         CDS       T01329                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100472103 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100472103
NCBI-ProteinID: XP_019654779
Ensembl: ENSAMEG00000011440
LinkDB All DBs
Position
Un
AA seq 694 aa AA seqDB search
MTALELQSVNWQVTSNRQAHHTDRFSSRELILRRGQSFSFSLSLNRGLGDGESLGFIVST
GPYPSESARTKAVFPLSNGTSHGGWSAQLVSKQDNILTISMASPVNAPVGVYTLSAQISS
RGKDFILKLGTFIQLFNPWLPEDGVFMNNHAEREEYVQEDAGIIYVGSTNRIGMVGWNFG
QFEEGILNICLSILDHSLNFRRDPATDVARRNDPKYVGRVLSAMVNGNDDNGVLSGNWSG
NYTGGLDPRNWNGSVEILKEWKKSGFRPVRYGQCWVFAGTLNTVLRCFGIPSRVVTNFNS
AHDTDRNLSVDVYYDPYGNPIEKGSDSVWNFHVWNEGWFVRTDLGPSYNGWQVLDATPQE
RSQGVFQCGPASVAAVREGDVNLDFDMPFIFAEVNADRITWIYDAYNNTQKRNASDTHSI
GRYISTKAVGSNSRVDITEKYKYPEGSSQERQVFEKALGKLKPHAAFGATSARHLAGEER
EPSISGKFKVTGLLEVGKEVNMALLLKNLTSDMKTVTVNMTAWTIVYNGTLVHEVWKDSV
TISLDPKEEIQHPVKITYAQYEKYLKADNMIRTTAVCQVSDEAEVLVERDIILDNPNLTL
EVLDQARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLRIDVPTLRPKERSRVRF
EILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacagctttagaactccagagtgtcaactggcaggtgacctccaaccggcaggcacat
cacacagacaggttctccagccgggagctcatcttgcgcagaggccagtccttcagtttc
tcattgagcttgaaccgaggtcttggcgatggagaaagtctgggttttatcgtctccaca
gggccttacccctcagagtcggccaggacaaaggctgtgtttccactctccaatgggaca
agccatgggggctggagtgcccagctcgtgtccaaacaggataatattctgaccatctcc
atggccagtcctgtcaacgcacctgttggagtgtacacgctgagcgctcagatctcctcc
cggggcaaagacttcattctgaagcttgggacgttcatacagctcttcaacccctggttg
ccagaggatggggtctttatgaataaccacgctgagagagaggagtacgtgcaggaagac
gccggcatcatctacgtggggagcacgaatcgaatcggcatggttggctggaactttgga
cagttcgaagaaggcattctgaacatttgcctctcgatcctggatcacagcctgaatttc
cgtcgtgaccctgctactgacgtggcccgcagaaatgaccccaaatacgtcggccgagtg
ctcagtgcgatggtcaacggcaatgatgacaacggtgtgctctccgggaattggagcggc
aactacacgggtggcctggacccacggaactggaacggcagcgtggagatcctcaaggag
tggaaaaaatcaggcttcaggccagtccgctacggccagtgctgggtctttgctgggacc
ctcaacacagtgctgagatgtttcgggattccctcccgagtggtcaccaacttcaactcc
gctcatgacacagaccggaacctcagtgtggacgtgtactacgacccctacgggaacccc
atagaaaaaggcagtgacagcgtgtggaatttccacgtctggaatgaaggctggtttgtg
cggactgacctgggcccttcgtacaacgggtggcaggttctggacgccaccccccaggag
aggagccaaggggtgttccagtgcggccccgcttccgtcgctgccgtccgagagggcgac
gtgaacctggacttcgacatgcccttcatctttgccgaggtaaacgccgaccgcatcacc
tggatctatgacgcctacaacaacacccagaagcggaatgcgtcggacactcacagcatt
ggcagatacatcagcaccaaggcggtgggcagcaactctcgcgtggacatcacggagaag
tacaagtatccagaaggttccagccaggagagacaagtgtttgaaaaggctttggggaaa
cttaaaccccacgcggccttcggcgccacgtctgcaagacacctggcaggagaggaaagg
gagcccagcatctcggggaagttcaaggtcactggcctattggaggtgggcaaagaagtc
aacatggccctcttgctgaaaaacctgacgagcgacatgaagacagtgaccgtgaacatg
accgcctggaccatcgtctacaacggcacgctggtacacgaggtgtggaaggactccgtc
acaatatccctggatcccaaagaagaaatacagcatcctgtgaagatcacatatgctcag
tatgagaagtacctgaaggcagataacatgatccggaccacggctgtgtgccaggtgtct
gacgaggccgaggtgttggtagaaagagacatcatcctggacaaccccaacctgaccctg
gaggtgctggaccaggcccgggtgcagaagcccgtgaacgtccagatgctcttctcgaac
ccgctggacgagccggtgaaagactgcgtgctgatggtggagggcagcggcctactgctg
ggcagcctccggattgacgtgccgaccctgcgccccaaggagcggtcccgggtgcgtttt
gagatccttcccacccggagtggaaccaagcagctgctcgccgacttctcctgcaacaag
ttccctgcgatcaaggccatgctgtccatcgacgtggccgagtga

DBGET integrated database retrieval system