KEGG   Ailuropoda melanoleuca (giant panda): 100473377Help
Entry
100473377         CDS       T01329                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100473377 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 821 aa AA seqDB search
MTDSPRSDVGRWGGNPWQPPTTPSPEPEPEPELDTRSRRGGRSFWARCCACCSCRNGTDG
DWGSEPHGDRGSRGRGSRSGSRRPDSRGSDSRRPGSRTGGVNAAGDGTIREGMLVVTGVD
LLSARSDQNRREHHTDEFEYDELIIRRGQPFHMVLHFSRPYESSDHVALELVIGNNPEVG
KGTHVIIPVGKGGSGGWKAQVTKASGQNLNLRVHTSPNAIIGKFQFTVRTRSEAGEFQLP
FDPHNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHG
VLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWV
GSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIY
FDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCS
VESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAVGSNM
RDDVTYIYKHPEGSEAERKAVETAAAHGSKPNVYASRDSAEDVAMQVEAQDAVMGQDLEV
CVVLSNRGGSPRTVKLHLYLSVTFYTGVTGPVFKESKKEVVLAPGATDRVSMPVAYKEYR
PQLVDQGSMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNP
LPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQLS
QVHGVIQVDVAPAPGGGGFFSDAGGNSGSGETIPMASRGGA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagtcctcgttcagacgtgggccgctggggcgggaacccctggcagcccccc
accacaccttctccagagccagagccagagccagagctggacacacggtcccgtcgggga
ggccgctccttctgggctcgctgctgtgcctgctgctcctgccgaaatgggacagatggt
gactggggatctgagccccatggagaccgaggctccaggggtcgagggtccaggtctgga
agtcgaagaccagactcacggggctcagattcccgccggcctggctcccggaccggtggt
gtgaacgcagctggagacggcaccatccgagagggcatgctggtggtgaccggtgtggat
ctcctgagtgcacggtcagaccagaatcgccgagagcaccacacagatgagtttgaatac
gatgagctgattatacgccgtggacagcctttccacatggtccttcacttctctcggccc
tatgagtcctctgatcatgtcgccttggagctggttatcggaaacaaccccgaggtgggg
aagggcacccacgtgatcatcccagtgggcaaggggggcagtggaggctggaaagcccag
gtgaccaaggccagcgggcagaatctgaacctccgggtccacacgtcccccaatgccatc
atcggcaagtttcagttcaccgtccgcacacgctccgaggctggcgagttccagttgccc
tttgacccccacaacgagatctacatcctcttcaatccttggtgcccagaggacatcgta
tacgtggaccatgaggattggcgacaggagtacgtgctcaatgagtctgggagaatttac
tatgggactgaagcccagattggcgagcggacctggaactacgggcagtttgatcatggg
gtgctcgatgcctgcctatacatcctggaccggcggggcatgccatatggaggccgtggg
gaccctgtcagtgtctcccgggtcatctctgccatggtgaactccttggacgacaatggg
gtcctgattggaaactggtccggtgattactctcgaggcaccaacccttccgcgtgggtg
ggcagcgtggagatcttactcagctacctgcgcaccggctactccgtcccctatggccag
tgctgggtcttcgccggcgtgaccaccacagtgctgcgttgcctgggcctggctacccgc
actgtcaccaacttcaactcagcacacgacacagacacatccctcaccatggacatctac
tttgatgagaatatgaagcccctggagcacctgaaccatgattctgtttggaacttccat
gtgtggaacgactgctggatgaagaggccagatctgccctcggggttcgatgggtggcag
gtggtggacgccacgccccaggagaccagcagtggcatcttctgctgtggcccctgctcc
gtggagtccatcaagaatggcctggtctacatgaagtacgacacgcccttcatttttgcc
gaggtcaacagtgacaaagtttactggcaacgacaggatgatggcagcttcaagatcgtg
tatgtggaggaaaaggccattggcacgctcatcatcacaaaggccgttggatccaacatg
cgggatgatgtcacctacatctataaacacccggaaggctcagaagcagagcggaaggca
gtggagacagcagccgcacatggcagcaagcccaacgtgtacgccagccgcgactcggca
gaggacgtggccatgcaggtggaggcccaggacgcggtgatggggcaggacctggaggtc
tgcgtggtgctgagcaatcgcggcggcagcccccgcaccgtgaagctgcacctgtacctc
tcagtcaccttctacaccggggtcacggggcctgtcttcaaggagagcaagaaggaagtg
gtgctggcgccaggggccacggaccgcgtgtccatgcctgtggcttacaaggaataccgg
ccccagctcgtagaccaggggtccatgctgctcaacgtgtcgggccacgtcaaggagagc
gggcaggtgctggccaagcagcataccttccgtctgcgcaccccagacctgtccctcaca
ttattgggggcagccgtggttggccaggagtgcgaagtacagattgtcttcaagaatccc
ctgcctgtcacactcaccaacgtcgtcttccggctggagggctccgggctgcagagaccc
aagatcctcaatgtgggggacattggcggcaacgagacagtgacactgcaccagaagttc
gtgcctgtgagaccaggcccccgccagctcatcgccagcttggacagcccacagctctcc
caagtgcacggtgtcatccaggtggacgtggctccagcccctgggggcgggggcttcttc
tcagatgctggaggcaacagtggctcaggggagaccatccctatggcatctcgaggtggg
gcttag

DBGET integrated database retrieval system