KEGG   Ailuropoda melanoleuca (giant panda): 100475939Help
Entry
100475939         CDS       T01329                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100475939 (HKDC1)
   00051 Fructose and mannose metabolism
    100475939 (HKDC1)
   00052 Galactose metabolism
    100475939 (HKDC1)
   00500 Starch and sucrose metabolism
    100475939 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100475939 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100475939 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100475939 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100475939 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100475939 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100475939 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100475939 (HKDC1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100475939 (HKDC1)
Membrane trafficking [BR:aml04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100475939 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYDMRLSDETLLDIMARFQAEMQKGLGKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGKRNVQMESQFYPTPNEIIR
GNGSELFDYVADCLADFMKTKGLKHKKLPLGLTFSFPCRQTKLEEGILLSWTKKFKARGV
QGTDVVSCLTKAMRKHKDIDVDILALVNDTVGTLMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRIILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRVNKKLARLRTTVGMDGTVYKIH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
REQLEDVQGKMRAEFEYGLKKDTHLTATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQTSIDKGTLIEWTKGFKATDCEGEDMVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGHEDPNCEIGLIAGTGSNMCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCIDDI
RTQYDKKVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAV
VEKRREDQGLEYLKITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTLMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtacatttgatggcattttacttcagcaagctgaaggaagatcagatcaag
aaggtggacaggttcctgtatgacatgcggctctccgatgagacccttttggacatcatg
gctcgcttccaggctgaaatgcagaagggcctggggaaggacaccaaccccacagccgcc
gtgaagatgcttcccacctttgtcagggccattccagatggctcagaaaatggggaattt
ctttctctggatcttggagggtccaaatttcgtgtcttgaaggtacaagtctctcaagag
gggaaaagaaacgtccagatggagagtcagttctacccaacacccaatgaaattatccga
ggcaatggctccgagctgtttgactacgtagctgactgtctggcagatttcatgaagacg
aaagggttgaagcataagaaattgccccttggcctaaccttctcttttccgtgcagacag
actaagttggaagaggggatcctgctttcatggaccaagaagtttaaggcacggggagtt
caaggcacagatgtcgtgagttgtctgaccaaagccatgagaaaacacaaggacatagac
gtggacatcctggccttggtcaatgacaccgtggggaccctgatgacatgcgcctatgat
gatccctactgtgaagttggtgtcatcattggcaccggcaccaacgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgatgaggggaggatgtgtatcaacacggag
tggggggccttcggcgacgacgggtccctggaagacatccgcaccgagttcgaccgggag
ctggacctcggctctctcaaccctgggaagcaactgtttgagaagatgatcagtggcctg
tacctgggtgaacttgtcaggatcatcttgctgaagatggccaaggcaggtctcctgttt
ggcggcgagaagtcctctgctctccacacaaagggcaagattgaaacacggcacgtggct
gccatggagaagtataaggaaggccttgccaatacaagagagatcctgacagatctgggc
ctggagccttcagaggccgactgcattgcggtccagcacgtctgcaccatcgtctccttc
cgttcagccaacctgtgtgcagcggccctggcagccatcctgacgcgcctccgggtgaac
aagaagctggcgcggctccgcaccacagtgggcatggacggcacggtctacaagatacac
cctcaataccccaaacgcctgcacaaggtggtgaggagactggtcccgaactgtgacgtc
cgcttcctcttgtcggagagtggcagcaccaagggggctgccatggtgacagcggtggcc
tcccgagtgcaggcccagcggaagcagatcgacaaggtgctggctctgttccagctgact
cgagagcagcttgaggatgtgcagggcaagatgcgggctgagttcgagtacgggctgaaa
aaggacacccacctgacggccacagtcaagatgctgcccacctacgtctgcgggatgccg
gatggcacagagaaaggaaagttccttgccctggatctggggggaaccaacttccgggtc
ctcctggtaaagatcagaagtggacggaggtcggtgcgaatgtacaacaagatctttgcc
atccccttggagatcatgcagggcaccggcgaggagctgttcgaccacatcgtgcagtgc
attgctgacttcctagactacatgggcctcaagggagcccagctgcctttgggcttcacg
ttctcatttccctgcaggcagacgagcatcgacaagggaacgctcattgagtggaccaaa
ggcttcaaggccacggattgtgaaggggaagacatggtggacatgctcagggaagccatt
aagaggagaaatgagttcgacctggacatagttgcagttgtgaatgacacagtgggtacc
atgatgacctgcggccatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggagatgaggaacattgaactggtggaaggggacgaaggg
aagatgtgcattaacacagagtggggaggatttggagataatggctgcatagacgacatc
cggacacaatatgacaagaaggtggatgaggggtccttgaaccctggcaaacagagatat
gagaaaatgaccagtgggatgtacctgggggagattgtgcggcagattctgatcgacctg
accaagcagggtctccttttccgtgggcagatttcagagcgtctccggaccaggggcatc
tttgaaaccaagttcctgtcccagattgaaagtgatcgactggccctcctccaggtcagg
aggatcctgcagcagctcggcctggacagcacatgtgaggacagcattgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcagcccagctctgcggcgccggcctggctgctgtc
gtggagaagaggagggaagaccaggggctggagtacctgaagatcaccgtgggagtggat
ggcacgctgtacaagctgcacccgcacttttctcggatattgcaggaaactgtgaaagag
ctagctcctcgatgtgatgtgacgctcatgctgtccgaagatgggagtggaaagggagct
gctctgatcactgctgtggccaagaggttacagcaggcccagaaggagaactag

DBGET integrated database retrieval system