KEGG   Ailuropoda melanoleuca (giant panda): 100475985Help
Entry
100475985         CDS       T01329                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     100475985 (POLRMT)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    100475985 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N VIR_N PPR_3 PPR_2
Motif
Other DBs
NCBI-GeneID: 100475985
NCBI-ProteinID: XP_011228501
Ensembl: ENSAMEG00000002745
LinkDB All DBs
Position
Un
AA seq 1233 aa AA seqDB search
MLALRWGHSASGFRRALWPAGRPGPLAEEGALSGVWGRRRRSSASPCEQDHQRDWGHAEL
LEVLEARVRQLQAECVSEATVKRVGVAQGLRASARLQPPGKAQAGPEGTAEELGGRWAQK
LDQEKFAMQKRKQQLELKLQVRAQQLACEYKLRVAPRLLDTQLAGRLQHWEQEVPEGLWE
EQLVWLLQEAPRKLSPEVEQAPKAGSASVQQEIRQQRLLAFLECCLLTDHLPLAHHVLVT
YHGRSRQQQRLTLAMYNTVMLGWARKGSFKELVYVFFMVKDAGLTPDLLSYAAALQCMGR
LDQDTSTIQRCLDQMARDGLKLQGLFTSVPLRQEEQAVVLKAVRKAQPTFSPPPPPRPPP
QVNTSPLLREIYAKSGPVSYPKLHLPLQSLQKLFREQLRMELATTVTVESVEKARVPTEE
VLQARDTLKQLRAEWAEALCLGLQELKASEAQAARSCLSAIFPYLCVLSERELAELLLQT
LQVLPPQGESLLSLAQQLGLRVFNRHTVQRKQLSSQVRALQRRYYRYLHLLASDTQVAAP
PLPRQYWEALGAPAAPHEQPWPLPVLVQLGKKLAEVLVEVVRMPGSLVTPQGSCTLIPVL
YHVYSFRSFRQIGILKPHPAFTELLAVAAEHTLTFEAAEVPMLCPPLPWMSPHTGAFLLS
PTKLMRSLEGTMQHQRLLPPPPPPPPPPAELHGALDALTQLGNCAWRVNGRVLDLVLELF
TAKGCPRLGVPAPPSEAPRPPDGRLPPSASSAQKAEVRREVARCLKVAREMHSLRSDALY
RLSLAQHLRDRVFWLPHNMDFRGRTYPCPPHFNHLGSDLARALLEFAQGRPLGPHGLDWL
KIHLVNLTGLKKHEPLRARLLFADEVMDDILDSADRPMTGRKWWMEADEPWQALACCMEI
ARAVRTADPTAYVSHFPVHQDGSCNGLQHYAALGRDSVGAASVNLLPSDLPQDVYSGVAA
QVEVFRRQDAERGVRVAQVLEGFISRKVVKQTVMTVVYGVTRYGGRLQIERRLRELSNFP
QEFVWEASHYLVRQVFNSLQEMFSGTRAIQHWLTESARLISHAGSAVEWVTPLGIPVIQP
YHQDSKVLISGGIQSLTFSQSGDTTQKPNTLKQKNGFPPNFIHSLDSSHMMLTALHCYRK
GLTFVSVHDCFWTHAADVEVMNQVCREQFVQLHSQPILHNLSRFLVKRFCSGARSPKHSK
NVWLGKLQDTLKSVPKTGAFDLEQVKHSTYFFS
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgctgcgctggggccacagcgcgtccggtttccggagggccctgtggccggcg
ggccgtcccggccccttggccgaggaaggggcactcagtggtgtctggggccgcagaagg
cgctcctctgccagcccttgtgagcaagaccaccagagggactggggccacgcggagctg
ctggaggtgcttgaggcacgggtgcggcagctgcaggccgagtgtgtgtcggaggccacg
gtgaagagggtcggcgtggctcaaggactccgagcatctgcccgtctccagccccccggg
aaggcccaggcagggcctgagggcaccgccgaggaactcggtggccgctgggcccagaaa
ctggaccaggagaagtttgcgatgcagaaacgcaagcagcagttggagctgaagctgcag
gtgcgagcccagcagctggcttgtgagtacaagctgcgggtggcgccccgcctgctggac
acccagctggccggtcgcctgcaacactgggagcaggaggtccccgagggcctctgggag
gagcagctggtgtggctgctgcaggaggccccccggaagctgagccccgaggtggagcag
gcccccaaggccgggagcgcctccgtgcagcaggagatccggcagcagaggctcctggcc
ttcctcgagtgctgcctgctcacggaccacctgcctctcgcccaccacgtgctggtcacc
taccacggccggtcccggcagcagcagcggctcacgctggccatgtacaacaccgtcatg
ctcggctgggctcgcaagggctccttcaaagagctggtttacgtgttcttcatggtgaaa
gacgctggcctcaccccagacctgttgtcctatgcagccgccctgcagtgcatgggacgg
ctggaccaggacaccagcaccatccagaggtgtctggaccagatggcccgggacgggctg
aagctgcaggggctcttcaccagcgtgcccctgcgccaggaggagcaggccgtggtcctg
aaggccgtgcgcaaggcccagcccacctttagcccgccgcccccgccacggcccccaccc
caggtcaacacctcaccactgctcagggagatctatgccaagagcgggcccgtgtcgtac
ccaaagctgcacctgccgctgcagtcgctgcagaagctcttccgggagcagctgcgcatg
gagctggccaccaccgtcaccgtggagtccgtggagaaggcccgggtgccgaccgaggag
gtcctgcaggcgcgggacaccctaaagcagctgcgggccgagtgggcggaggcactgtgc
ctcgggctgcaggaactgaaggccagcgaggcccaggctgcccgctcctgcctctccgcc
atcttcccgtacctgtgcgtgctgagcgagagggagctcgccgagctgctgctgcagacc
ctccaggtgctgcccccgcagggagagtcgctcctctccctggcacagcagctgggcctg
cgcgtcttcaaccggcacacggtgcagaggaagcagctgagcagccaggtgcgggcgttg
cagcggcgctactaccgctacctgcacctgctggcctccgacacccaggtggcggcgccc
cccttgccgcggcagtactgggaggcactgggggcgcccgcggccccccacgagcagccc
tggcccctgcctgtgctggtacagctgggcaagaagctagccgaggtgctggtggaggtc
gtgcgcatgcccggcagcctggtcaccccacagggctcctgcacgctcatccccgtgctc
taccacgtgtactccttccgcagcttccgccagatcgggatcctgaagccacacccggcc
ttcaccgagctgctggcggtggccgcggagcacacgctgaccttcgaggcggccgaggtg
cccatgctgtgcccgccgctgccctggatgtcgccgcacacgggtgccttcctgctgagc
cccaccaagctcatgcgctcgctggagggcaccatgcagcaccagcgtctgctccccccc
cccccgccgccgccgccgccgcccgccgagctgcacggcgccctggacgccctcacgcag
ctgggcaactgcgcctggcgcgtcaacgggcgcgtgctggacctggtcctggagctcttc
accgccaagggctgcccccgcctgggtgtgccggccccgccttctgaggcaccgcggcca
cccgatggccgcctgccgcccagcgcctcgtccgcccagaaggccgaggtgcggcgggag
gtggcccgctgcctgaaggtggcacgggagatgcacagcctgcgctcggacgccctgtac
cgcctctccctggcccagcacctccgggaccgcgtcttctggctgcctcacaacatggac
ttccgcggccgcacctacccctgcccgccccacttcaaccacctgggcagcgacctggcg
cgtgccctgctcgagtttgcccagggccgcccgctgggcccccacggccttgactggctc
aagatccacttggtcaacctcacggggctcaagaaacacgagcccctgcgggcgcgcctg
ctcttcgcggacgaggtcatggacgacatcctggactctgccgaccggcccatgacgggc
cggaagtggtggatggaggcggatgagccctggcaagccctggcttgctgcatggagatc
gctcgagccgtgcgcaccgccgaccccacggcctacgtctctcacttcccggttcaccag
gacggctcctgtaatggcctgcagcactacgccgccctgggccgggacagcgtgggggcc
gcctccgtcaacctgctgccctcggacctgccccaggatgtgtacagtggggtggccgca
caggtggaggtgttccgcaggcaggacgctgaacggggtgtgcgggtggcccaagtgctt
gaggggttcatcagccgcaaggtggtcaagcagacggtgatgaccgtggtgtacggggtg
acccgctacgggggccgcctgcagatcgagaggcgcctgcgggagctcagcaacttcccc
caggagttcgtgtgggaggcctctcactacctggtgcgccaggtgttcaacagcctgcag
gagatgttctcgggcacccgggccatccagcactggctgaccgagagcgcccggctcatc
tcccacgcgggctcagccgtggagtgggtcacacccctgggcatccccgtcatccagccc
taccatcaggactccaaggtgttgatcagtggcggcatccagagcctaaccttcagccag
agcggggacaccacccaaaagcccaacacgctgaaacagaagaatggcttcccccccaac
ttcatccactcgctggactcttctcacatgatgctgacagccctgcactgctacaggaaa
ggcctgacctttgtctccgtgcacgactgcttctggacccacgcggctgacgtggaggtc
atgaaccaggtgtgccgggagcagtttgtccaactgcacagccagcccatcctgcacaac
ctgtccaggtttctggtgaagcgattctgttcaggcgccaggtcccccaagcactccaag
aacgtgtggcttggcaagctgcaggacacgctgaagtccgtgcccaagacaggggccttc
gacctggagcaggtgaagcactccacttacttcttcagctga

DBGET integrated database retrieval system