Ailuropoda melanoleuca (giant panda): 100478918 Help Entry 100478918         CDS       T01329                                  Name (RefSeq) alpha-1-antiproteinase   KO K03984   alpha-1-antitrypsin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04610   Complement and coagulation cascades Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04610 Complement and coagulation cascades     100478918  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:aml01002]     100478918   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100478918 Peptidases and inhibitors [BR:aml01002]  Peptidase inhibitors   Family I4: serpin family    100478918 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100478918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Serpin Motif Other DBs NCBI-GeneID:  100478918 NCBI-ProteinID:  XP_034509024 Ensembl:  ENSAMEG00000029564 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MSISGTYDLKTVLSKMGITKVFSNEAELSGITEKEPLMLSKGLHKAVLTVDEKGTEAAGT TVLEAIPMSMPPVVDFSSPFLVIIYDRNTKSPLFVGKVVDPTQK NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtccatttctggaacctatgatctgaaaaccgtcctgagcaaaatgggtatcaccaag gtcttcagcaacgaggctgagctctcggggatcacagagaaagagcccctgatgctgtcc aaggggctgcataaggctgtgctgactgtcgatgagaaagggacagaagctgctgggact acggttctggaagccatccccatgtcgatgccgccagtggtcgacttcagcagccccttc ctcgtcatcatctatgatagaaacaccaagagccccctcttcgtgggaaaggtggtggac cccacccagaagtaa

DBGET integrated database retrieval system