KEGG   Ailuropoda melanoleuca (giant panda): 105238755Help
Entry
105238755         CDS       T01329                                 

Gene name
TGM5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105238755 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 719 aa AA seqDB search
MEQGLEVALTDLQSTWNNMRHHTDEISSDRLLVRRGQAFNITLYFRNRGFQPGLDNIIFV
AETGPLPDLSNGTRALFSLTGRHGPSPWIASLETNGASSLEVSLCAPPVAAVGRYLLKVH
IDSFQRSVTAYQLGEFILLFNPWCPEDSVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDSGVLNG
NWSENYLDGVNPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAIMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDSTGRILENKKKDSVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVELNYDTAFAFSMVNADCMSWLVYGGKEQKIHRDT
NTVGNFISTKSIQSDERDDITENYKYIEGSPQERQVFLKALQKLKAGRSEDPHQADSQHS
LPEPRSGDGLWSLHTPSLRPSDIVQVSLKFQLLDPPHMGQDIRFVLLALNMSLQFKDLKV
NLSAQSLLHDGSPLPPFWQDTAFITLSPEEAKTHSCRIPYSQYSQYLSTDKLIRISALGE
EKSSPEKILVDKIITLAYPGIIINVLGAAVVNQPLSIQVLFSNPLSEHVEDCVLTVEGSG
LFKKQQRVLIGVLKPQHRASITLETVPFKSGQRQVQANLRSNKFKDIKGYRNVYVDLRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagggctagaggtggccctcacagacctccagagcacctggaacaacatgcgg
caccacacagatgagatcagctctgaccgcctcctagtccgccggggccaggccttcaac
atcactctgtacttcaggaaccggggcttccagccaggcctagacaatatcatcttcgtg
gctgagactggaccccttccagacctgtccaatggcactcgagccctgttcagcctgaca
ggtcgtcatggccccagcccgtggattgcctcgctggagaccaatggggccagctccctg
gaggtgagcctgtgcgcccctcctgtggcagctgtaggtcggtatctcttgaaagttcat
attgactctttccagaggtctgtcacagcctaccagcttggggagttcatcctgctcttc
aatccctggtgcccagaggattctgtctacttggacagtgagccccagaggcaggaatat
gttgtgaacgattatggcttcatttaccaagggaacaagaactggattcgcccatgcccc
tggaactatggacagtttgaagagaatatcatagacatctgcctggagctgctagacaag
agcctgaacttccagatcgacccagccacagactgtgcccttcggggaagccccgtctac
atcagcagagtggtgtgtgccatgatcaatagcaacgatgacagcggggtgctcaatgga
aactggagtgagaattacttagatggcgtcaaccctgcagagtggacgggcagcgtggcc
atcctgaaacagtggcatgccacaggctgccagccagtgcgctacgggcagtgctgggtc
tttgctgccatcatgtgcacagtgatgaggtgcctggggatccccacccgcgtgatcacc
aactttgactccggtcatgacacagatggaaacctgatcatagatgagtattatgacagc
acgggcaggatcttggagaataagaagaaggacagtgtctggaattttcacgtgtggaat
gagtgctggatggcccgaaaggacctccctcctggatatggaggctggcaggtgttggat
gccacacctcaggagacgagcaacggcctctactgctgcggccctgcctctgtcagagcc
atcaaagagggagaggtggagctgaactatgacacagcctttgctttttccatggtgaat
gctgactgcatgtcctggcttgtctatggagggaaggagcagaaaattcaccgggacacg
aatactgttggcaattttatcagcaccaagagcattcaaagtgatgagcgagatgacatc
acagagaactacaaatacatagaaggttcccctcaagagagacaggtgttcctgaaggct
cttcagaagctgaaggctggaaggtccgaagacccccaccaagcagactcacaacattcc
ctacctgagccacggagcggggatggcctttggagcctgcatacaccttcccttcggccc
agtgatattgtccaggtctccctgaaatttcagctgctggacccgccccacatgggccag
gacataagatttgtcctgctggccctcaacatgtcactccagttcaaggacctcaaagtg
aacctaagtgcccaatccctgctgcatgatggcagccccctgccccctttctggcaggac
acagccttcatcacgctctctcctgaagaagcaaagacccattcctgtagaattccctat
tcccagtatagccagtacctgtcaacagacaagctgatccgcatcagtgccctaggtgaa
gagaagagcagtccagaaaagatcctggtggacaagatcatcaccctagcctatccaggc
atcataattaatgttttaggagctgctgttgtgaaccagccactctccatccaggtgctg
ttttcgaaccccctctcagagcacgtggaagactgtgtgctgactgtggaaggaagcggg
ctcttcaagaaacagcagagagtcctcattggagtcctcaaacctcaacacagggccagc
atcactctggagactgtccccttcaagagtggccaaaggcaggtccaagcaaatctgagg
agcaacaagtttaaggacatcaagggttacaggaatgtctatgtagacttgaggttataa

DBGET integrated database retrieval system