KEGG   Amycolatopsis mediterranei S699: AMES_7760Help
Entry
AMES_7760         CDS       T02190                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00250  Alanine, aspartate and glutamate metabolism
amm00410  beta-Alanine metabolism
amm00640  Propanoate metabolism
amm00650  Butanoate metabolism
amm01100  Metabolic pathways
amm01120  Microbial metabolism in diverse environments
Module
amm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMES_7760 (gabT)
   00650 Butanoate metabolism
    AMES_7760 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMES_7760 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMES_7760 (gabT)
Enzymes [BR:amm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMES_7760 (gabT)
Amino acid related enzymes [BR:amm01007]
 Aminotransferase (transaminase)
  Class III
   AMES_7760 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 GGN
Motif
Other DBs
NCBI-ProteinID: AFO81293
UniProt: G0G6G0
LinkDB All DBs
Position
8677068..8678324
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLYDLEGKRHLDFTAGIGVTSTGHCHPHVVRAAQEQIG
KLVHGQYTTVMHKPLLELTERLGEVLPGGLDSLFYANSGSEAVEAALRLSRQATNRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGIGPLMTGVHVAPFPYAYHYGWDEQTATKFALREL
DYLFQTVCAPNETAAFFVEPVLGEGGYVPANTEFLAGLRERADRHGILLVVDEIQTGFGR
TGKFWGHDHFDVSPDIVLIAKGLASGFPLSGIAASQELMAKAFPGSQGGTYGGNAVSCAA
AIATLEVIQQENLVENAAERGRQLLEGARVIADKTPSIGEVRGLGLLVGSEFSTADGEPD
TPTAQAAQQAAAKSGLLLLTCGPYMNVVRMVPPLVVTAEQVDDALRIWGDVVASVTGS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagctctctccgctgctcaagcaggcaacgcccgtcgtggtcgaccacggtgaa
ggggtttacctctatgacctcgagggcaaacgccacctcgacttcaccgccggtatcggc
gtcacgagcaccgggcactgccacccccacgtggtgcgggccgcgcaggagcagatcggc
aagctcgtccacggccagtacacgacggtcatgcacaagccgctcctcgaactcaccgag
cgcctcggcgaggtcctgcccggcgggctcgactcactcttctacgcgaactcgggcagc
gaagccgtcgaagcggcgttgcggctttcgcggcaggcgacgaaccgcccgaacgtcatc
gtcttccagggtggcttccacggccggacggtcgccgccgcgaccatgacgacgtccggg
acgcggttcagcgccggcatcggcccgctgatgaccggcgtgcacgtcgcgccgttcccg
tacgcctaccactacggctgggacgagcagacggcgacgaagttcgcgctgcgcgagctg
gactacctcttccagaccgtctgcgcgccgaacgagaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcgggtacgtcccggcgaacaccgagttcctggccggcctgcgcgag
cgcgccgaccggcacggcatcctgctcgtcgtcgacgagatccagaccggcttcggccgc
accgggaagttctggggccacgaccacttcgacgtctcccccgacatcgtcctcatcgcg
aagggcctggccagcggcttccccctgtccggcatcgccgcttcgcaggagctgatggcg
aaggcgttccccggctcgcagggcgggacgtacggcggcaacgcggtttcgtgcgccgcg
gcgatcgcgacgctcgaggtcatccagcaggagaacctggtcgagaacgccgccgagcgc
gggcgccagctgctcgaaggcgcgcgggtgatcgcggacaagacgccgtcgatcggcgaa
gtgcgcgggctcgggctgctggtcggctcggagttcagcaccgccgacggcgaaccggac
acgcccaccgcgcaggccgcccagcaggcggcggcgaagagcgggctgctgctgctcacc
tgcgggccgtacatgaacgtcgtccggatggtgccgccgctggtcgtcaccgccgagcag
gtcgacgacgcgctgcggatctggggcgacgtcgtcgcctcggtcacggggagctga

DBGET integrated database retrieval system