KEGG   Amycolatopsis mediterranei S699: RAM_40855Help
Entry
RAM_40855         CDS       T01822                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K01616  
2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
amn  Amycolatopsis mediterranei S699
Brite
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     RAM_40855 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8746225..8749932
Genome map
AA seq 1235 aa AA seqDB search
MSSSSPASQFGPNEWLVEEMYDQFLADPSSVDAAWHDFFADFKPTQSAQAKADTARQQQA
GAKPAANGQAAQPSAKAVQNAESAAKQSSTAPAAKPAPAKAAPKQAPKPAAKAEPKAEAK
KEEPESKQLRGAAAAIAKNMDASLSVPTATSVRAVPAKLMADNRIVINNHLKRTRGGKIS
FTHLIGYAMVRALKAYPNMNRHYQLIDGKPFAITPEHVNFGLAIDMKGKDGSRTLVVASI
KGCEDMSFLQFWQAYEDIVKKARNNKLTADDFSGTTISLTNPGGIGTNHSVPRLQAGQGA
IIGVGAMQYPAAFEGTSEKTLVDLGISKIMTLTSTYDHRIIQGAESGEFLKRIHQLLLGE
DGFYDDVFTSLRLPYEPIRWVADIPDGPVDKTARVIELIDAFRMRGHLMADTDPLNYRQR
SHADLDVLSHGLTLWDLDREFPVGGFAGQERMKLRDILGVLRNSYCRTVGIEYTHILDPE
ERRWIQERVEIPHEKPDPAVQKYVLSKLNAAEAFETFLQTKYVGQKRFSLEGGETAIPLL
DTILDKAAEHELDEVVIGMPHRGRLNVLANIVGKPISQIFQEFEGNLDPGQAHGSGDVKY
HLGAEGKYFRMFGDGETKVSLTANPSHLETVDPVLEGIVRAKQDILDKGGEGYTVLPVLM
HGDAAFAGQGVVAETLNLSLLRGYRTGGTVHVIVNNQVGFTTAPEHSRSSQYATDVAKMI
GSPIFHVNGDDPEAAHWVAKLAVEYRQAFHKDVVIDLICYRRRGHNEGDDPSMTQPAMYD
IIDTKRSVRKTYTESLIGRGDISVEEAEAALRDFSSQLEHVFNEVRELEKHPAKASPSVE
EEQQVPAKVATAITGKTLEHIGDAFVNVPDGFTPHPRVKPVMERRHKMSREGDIDWAFGE
LLAFGSLAMEGRLVRLSGQDSRRGTFTQRHSVFIDRKTGQEYSPLQNLADGQGRVMIYDS
ALSEYAAVGFEYGYSVANPESLVMWEAQFGDFVNGAQTVIDEYISSGEAKWGQRSDVVLL
LPHGHEGQGPDHTSGRIERFLSLCAEGSMTVAVPSTPANYFHLLRRHALDGIQRPLVVFT
PKSMLRNKAATSPTEDFTGESRFMSVIDDVTPDPAKIRKVLLTSGKLYWELVAERTKREA
DDVAIVRIEQYYPLPKKKLLAALERYTNATQVAWVQEEPENQGAWPFFGLNLPRKFPEVL
SGLQVVSRRPMAAPSAGSSKVHEVEQKALIAKAFD
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcagcagccctgcgtcacagttcggccccaacgagtggctggtcgaagagatg
tacgaccagttcctcgcagacccttcttcagtcgatgccgcctggcacgacttcttcgcg
gacttcaagccgacgcagagcgcgcaggccaaggcggacaccgcccggcagcagcaggcc
ggagccaagccggcggccaacggccaggcggcgcagccctcggccaaggccgtgcagaac
gcggagtcggcggccaagcagtcgtcgacggcgccggccgccaagccggcccccgcgaag
gcggccccgaagcaggcgccgaagccggccgcgaaggccgagcccaaggccgaagcgaag
aaggaagagccggagtcgaagcagctgcgcggcgccgcggcggccatcgccaagaacatg
gacgcctcgctgagcgtccccaccgcgaccagcgtgcgcgcggtcccggcgaagctgatg
gcggacaaccgcatcgtcatcaacaaccacctcaagcgcacccgcggcggcaagatctcc
ttcacgcacctcatcggctacgccatggtgcgggcgctgaaggcgtacccgaacatgaac
cggcactaccagctgatcgacgggaagccgttcgcgatcacgccggagcacgtcaacttc
gggctcgcgatcgacatgaagggcaaggacggctcccgcacgctcgtcgtggcctcgatc
aagggctgcgaggacatgtcgttcctgcagttctggcaggcctacgaggacatcgtcaag
aaggcccgcaacaacaagctcaccgccgacgacttctccggcaccacgatctcgctgacc
aacccgggcggcatcggcaccaaccactcggtgccgcgcctgcaggccggccaaggcgcc
atcatcggcgtcggcgccatgcagtacccggccgccttcgagggcaccagcgagaagacg
ctggtcgacctcggcatcagcaagatcatgacgctgacctcgacctacgaccaccgcatc
atccagggcgcggagtcgggcgagttcctcaagcgcatccaccagctgctgctcggcgag
gacggcttctacgacgacgtcttcaccagcctgcgcctgccgtacgagccgatccgctgg
gtcgccgacatcccggacggcccggtcgacaagaccgcccgcgtgatcgagctgatcgac
gcgttccggatgcgcggccacctgatggccgacaccgacccgctgaactaccgccagcgc
agccacgcggacctggacgtgctgtcccacggtctcacgctctgggacctcgaccgcgag
ttcccggtcggcggcttcgccggccaggagcggatgaagctgcgcgacatcctcggcgtg
ctgcgcaactcgtactgccgcacggtcggcatcgagtacacccacatcctcgaccccgag
gagcgccgctggatccaggagcgcgtcgagatcccgcacgagaagccggaccccgcggtc
cagaagtacgtgctctcgaagctgaacgccgccgaggcgttcgagacgttcctgcagacc
aagtacgtcggccagaagcggttctcgctcgagggcggcgagacggcgatcccgctgctc
gataccatcctcgacaaggccgccgagcacgagctcgacgaggtcgtcatcggcatgccg
caccgcgggcggctgaacgtgctggcgaacatcgtcggcaagccgatcagccagatcttc
caggagttcgagggcaacctcgacccgggccaggcgcacggctccggtgacgtgaagtac
cacctcggcgccgagggcaagtacttccggatgttcggcgacggcgagaccaaggtgtcg
ctgacggcgaacccgtcccacctggagacggtcgacccggtgctcgagggcatcgtccgc
gccaagcaggacatcctggacaagggcggcgagggctacaccgtgctgccggtcctgatg
cacggcgacgcggccttcgcgggccagggcgtcgtcgccgagacgctgaacctgtcgctg
ctgcgcgggtaccgcaccggcggcaccgtgcacgtcatcgtcaacaaccaggtcggcttc
acgaccgcgccggagcactcgcgctcgtcgcagtacgccaccgacgtcgcgaagatgatc
ggctcgccgatcttccacgtgaacggcgacgaccccgaagccgcgcactgggtggccaag
ctcgccgtcgagtaccgccaggcgttccacaaggacgtcgtcatcgacctgatctgctac
cgccgccgcggccacaacgagggcgacgacccctcgatgacgcagccggcgatgtacgac
atcatcgacaccaagcgttcggtgcggaagacctacaccgagtcgctgatcggccgcggc
gacatctccgtcgaggaggccgaggccgcgttgcgcgacttctcgagccagctggagcac
gtcttcaacgaggtgcgtgagctggaaaagcacccggcgaaggccagcccctccgtcgag
gaggagcagcaggtgccggccaaggtggcgacggcgatcaccggcaagacgctggagcac
atcggcgacgcgttcgtgaacgtgccggacggcttcaccccgcacccgcgcgtcaagccg
gtcatggagcgccgccacaagatgtcccgcgagggcgacatcgactgggcgttcggcgag
ctgctggcgttcgggtcgctggcgatggaaggccggctggtccggctgtccggccaggac
tcgcgccgcggcacgttcacccagcggcactcggtgttcatcgaccgcaagaccggccag
gagtactcgccgctgcagaacctggccgacggccagggccgcgtgatgatctacgactcg
gcgctgtcggagtacgcggccgtcggcttcgagtacggctactcggtggccaaccccgag
tcgctggtcatgtgggaagcgcagttcggcgacttcgtcaacggcgcccagacggtgatc
gacgagtacatctcctccggcgaggccaagtggggccagcgttcggacgtcgtgctgctg
ctgccgcacggccacgagggccagggcccggaccacacgtccggccgcatcgagcgcttc
ctctcgctgtgcgcggagggctcgatgacggtggcggtcccgtcaaccccggcgaactac
ttccacctgctgcgccgccacgccctcgacggcatccagcgcccgctggtcgtcttcacg
ccgaagtcgatgctgcgcaacaaggccgcgacctcgccgaccgaggacttcaccggcgaa
agccggttcatgtccgtcatcgacgacgtcaccccggacccggcgaagatccgcaaggtg
ctgctgacctccgggaagctgtactgggagctggtggcggagcggacgaagcgcgaggcc
gacgacgtcgcgatcgtgcggatcgagcagtactacccgctgccgaagaagaagctgctg
gcggcgctggagcgctacacgaacgcgacgcaggtcgcgtgggtccaggaggagccggaa
aaccagggtgcgtggccgttcttcggcctgaacctgccccggaagttcccggaggtgctc
tcgggcctgcaggtcgtgtcgcgccgcccgatggcggccccgtcggccggctcgtcgaag
gtgcacgaggtcgagcagaaggcgctgatcgcgaaggcgttcgactga

DBGET integrated database retrieval system