KEGG   Actinoplanes missouriensis: AMIS_49650Help
Entry
AMIS_49650        CDS       T01795                                 

Definition
(GenBank) putative NRPS
Organism
ams  Actinoplanes missouriensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5254032..5259242)
Genome map
AA seq 1736 aa AA seqDB search
MEQSVVRASTFVDVVAARAEFSEKVAFEFAGPNEAAPSRLSFAELHDRAASIAALLAGRV
APGDRVLVLLPPGLDYVASFLGCLYAGVIAVPLYPSNGKIYSARSRAVFADSAPAAALVP
GSVIDGGDEGAAGIAGLPLIAVDGELPAPGEWRRPSIDGDTVAFLQYTSGSTATPRGVVV
THRNLVANSRQIRDHFGTTPDTRVVSWLPPYHDMGLIGGILQPLFAGTTSTLFSPVSFIA
QPLRWLRLISETGARISGGPNFAYDLCVDRIPEQQLAGLDLSRWEVAFNGAEPVRARTLE
RFADRMAPYGFRRGAFFPCYGLAEATLLVSGRSVGDSPIAETFDPGSLAPGSAPVTAETG
LPVVGCGTVAGDLTVTVTDPETGAAVPPATVGEIRAAGDNVAAGYWGQDSTATFGQAPGD
PLRTGDLGFLRDGQLFVTGRIKDLVVVRGRNHYPQDLEQSALDAHPSLRRGAAAFAVDRD
DREEVCLVLETSIAHRPDEMAEAAARVRMRLATEHGVTPGSLVFVRPGQIPRTTSGKVQR
AQARAMLADGSMMVAYRWDAGPAGNGLAPLPEHLRSEITRETLLDLLRQRLGSDVDPAAP
LVAQGLDSLAALELRAAVERATGQELPLAGLLAGATVDTLLDDLTEHTRAAAPPVTATSS
GRHPLAYGQQALWILEQQHPDSSVQHIYAALRFRRPVDVGALHRTFQTLTDRHPALRTSL
HWAADGESYQQVHRRQEVDFLVEDASGLDEGEFAARIRREILGERLDLAAGRPLQVTLFR
RPAGDVLSMVLHHVAGDMWSVAVLTDELGRLYTRETGGNVTVAPAPVADFVEYGRRQRAL
LDSPHGQRLWEYWKNELDGSDTVLELPADRPRPPALTYQGDTVSLTLDSNLTAALRTLSA
GQGTTLFVTLMAVFQTLVRRYTRQDDFLIGVPASGRGDEDMHGVVGYFVNPVLIRTRDGA
DRSFADQIAETRQKVAGAMRHQDMPFPVLVERLGLVRDASRPPGYQVMFSFTRSHLPDGN
GIAALNHGKAGVPVRIGGLEAESLDMVRRTAQVDLTMVVSEVGDHLEAGINFSTDIFDRE
TVERFGADFAELARRLEADPRTPMNRIPSIRDEELRQIAAWNDTSTRYPRESSVVELFAE
QVAARPGEPALTYGALTRTYRELDAISGALAHRLIRLGVRPEDRVGLYVDRDPAVVVAML
AIAKAGAAYVPLDPAHPPHRLLQILDESAPVLILAPDDRTAGAAAWNPGLPTLDPAGFLD
VPAGDAPTVTAGPSAESLLYVMYTSGSSGTPKGICITHRNVVRLVRGTGYFSLAPGDRMA
QVSNAAFDAATLEIWGALLNGGHLIGFDKQTVLSPPRLATALRDHDIHTVVLATPLFAQL
TGYDPKTFAGTRQLLVGGDSMDPKRAREVAELGGPLLTNGYGPTESTTFATTQPLPVVAD
DVWRLPIGGPIANTRVYVLDEQWNPVPVGVPGQLFIGGDGLGRGYLGRPALTAEKFVPDP
FSDIPGSRMYATGDLARWLPGGVIDFLGRIDFQVKVRGFRIELGDIDAALTSHPGVGEAV
TVVDESTGDKRLAAFYSGTVETAELTAHLTERLPEYMVPGILVRLDELPKNPNRKIDRAA
LRVPTGEGAPVTGGDGGSDLEGEIVALLTEVLGRADVDPDDNFFEIGGHSLLAIRLLAQI
KQTYGVDLDLSDLFTDPTARAVAEQIAERRGAVPEPAAATGPTAVSRDAYAARRPR
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtcggttgtccgggcctcgacattcgtcgacgtcgtcgccgcacgagcagag
ttctcggagaaggtcgcgttcgagttcgccggcccgaacgaggccgcaccgtcccgcttg
agcttcgccgagctgcacgaccgggccgcctcgatcgcggcgctgctggccgggcgggtg
gcccccggagaccgggtgctggtgctgctgccgccgggactggactatgtggcgtcgttc
ctcggctgcctctacgccggagtcatcgccgttccgctctacccgtcgaacggcaagatc
tactcggcccggtcccgggccgtgttcgccgactcggcgccggctgccgccctggtgccc
ggcagtgtgatcgacggcggggacgagggcgcggcggggatcgccgggctgccgctcatc
gccgtcgacggggagctgcccgcacccggcgagtggcgacggccctcgatcgacggcgac
accgtggcgttcctgcaatacacctccggctccacggcgacgccccgcggcgtcgtcgtc
acccaccgcaacctggtcgccaactcccggcagatccgcgaccacttcggcaccacaccc
gacaccagggtggtgagctggcttccgccgtaccacgacatgggtttgatcggtgggatt
ctgcaaccgctgttcgccggaacgacgagcaccctcttctcaccggtgtcgttcatcgcg
caaccactgcgctggctgcgactgatctccgagaccggcgcccggatcagtggtggcccc
aacttcgcctacgacctgtgcgtcgaccggatcccggagcagcagctcgcgggcctggac
ctgtcgcggtgggaggtcgccttcaacggcgccgagccggtgcgggcgcgcacgctcgaa
cggttcgccgaccggatggctccctacgggttccgccgcggcgcgttcttcccctgctac
ggactcgccgaggcgaccctgctggtctccggtaggagcgtcggcgacagcccgatcgcc
gagaccttcgatcccggctccctggcgcccggcagcgcgccggtcacggcggagaccggg
ctgcccgtggtcggctgcggcaccgtcgccggcgacctgaccgtgaccgtcaccgacccg
gagaccggggccgcagtcccgccggcaaccgtcggcgagatccgggcggcgggtgacaac
gtcgcggccggttactggggccaggactccacggccacgttcggacaggcgcccggcgat
ccgctgcgcaccggtgacctcggtttcctccgtgacgggcagctgttcgtcaccggccgg
atcaaggatctggtcgtggtccgcggccgcaaccactacccgcaggacctggaacagagc
gccctcgacgcgcatccctccctgcggcgtggtgccgccgccttcgccgtggaccgcgac
gaccgggaggaggtgtgcctggtcctggagacctcgatcgcccaccggccggacgagatg
gccgaggccgcggcccgggtacggatgcggctcgccaccgagcacggcgtcacccccggc
agcctcgtcttcgtccggcccggccagatcccccgcaccaccagcggcaaggtccagcgc
gcccaggcccgggccatgctcgccgacggatcgatgatggtggcgtaccgctgggacgcc
ggcccggccggcaacggtctcgccccgcttcccgagcacctgcgctcggagatcacccgg
gagaccctgctcgacctgctgcgccagcgcctcggttccgatgtcgacccggccgccccg
ctggtggcgcagggcctggactcgctggccgccctggaactgcgcgccgccgtcgaacgg
gccaccggccaggagctcccgctcgccgggctgctcgccggcgccaccgtcgacaccctg
ctcgacgacctgaccgagcacacccgcgccgccgcgccgcccgtcaccgcgaccagctcg
ggacggcacccgctcgcctacggccagcaggccctctggatcctggagcagcagcacccg
gacagctccgtgcagcacatctacgccgcgctccggttccgccggcccgtcgacgtggga
gccctgcaccggaccttccagacgctcaccgaccggcacccggctctgcgtacgtccctg
cactgggccgccgacggagagtcctatcagcaggtccaccggcggcaggaggtcgatttc
ctcgtcgaggacgcgtccggcctcgacgagggggagttcgccgcccgcatccgccgcgag
atcctgggtgagcgcctcgacctggcggccgggcggccgctccaggtcaccctgttccgc
cggcccgccggtgacgtgctgtcgatggtgctgcaccacgtcgccggtgacatgtggtcg
gtcgccgtgctcaccgacgagctcgggcggctctacacccgcgagaccggcgggaacgtc
accgtcgcaccggcgccggtggcggacttcgtggagtacgggcgccggcagcgggccctg
ctggactcgccgcacgggcagcgcctgtgggagtactggaagaacgagctcgacggcagc
gacaccgttctcgaactgcccgccgaccggccccgcccgccggccctgacgtaccagggc
gacaccgtctccctcaccctggacagcaacctcaccgcggccctgcgcaccctctccgcc
ggccagggcacgaccctgttcgtcacgctgatggcggtgttccagaccttggtccgccgg
tacacccggcaggacgacttcctgatcggggttcccgcctcggggcgcggcgacgaggac
atgcacggtgtcgtgggctacttcgtcaatccggtcctgatccgcacccgtgacggagcc
gatcgcagtttcgccgaccagatcgccgagaccaggcagaaggtggccggcgcgatgcgg
caccaggacatgccgttccccgtgctcgtggaacggctgggtctcgtccgggacgcctcc
cggccgcccggctaccaggtgatgttcagcttcacccggtcgcacctgccggacggcaac
ggcatcgccgccctcaaccacgggaaggccggcgtcccggtccggatcggcggtctcgaa
gccgaatccctcgacatggtccgccgcaccgcccaggtcgacctcaccatggtggtcagc
gaggtcggcgaccacctcgaagccggcatcaacttctccaccgacatcttcgaccgggag
accgtcgaacggttcggcgccgacttcgccgaactggcccggcggctggaagccgacccg
cgtacccccatgaaccggatcccgtcgatccgtgacgaggaactgcggcagatcgccgcc
tggaacgacaccagcacccgctatccgcgggagagctccgtcgtggagctgttcgccgag
caggtggccgcccggcccggcgagcccgccctcacctacggcgcgctcacccgcacctac
cgggagctcgacgcgatctccggagcgctcgcgcaccggctgatccgactcggggtgcgc
cccgaggaccgggtcgggctctacgtcgaccgggatccggcggtcgtcgtcgccatgctg
gccatcgccaaggccggcgccgcctacgtcccgctcgacccggcgcacccgccgcaccgc
ctcctgcagatcctcgacgagtccgcgccggttctgatcctggccccggacgacaggacc
gccggcgccgcggcgtggaaccccggcctgcccaccctcgacccggcgggcttcctcgac
gtccccgccggcgacgcgcccacggtcaccgccgggccgtccgccgagagcctgctctac
gtgatgtacacgtccgggtcgtccggcaccccgaagggcatctgcatcacccaccgcaac
gtcgtccggctcgtccgcggcaccggctacttctccctcgcccccggcgaccggatggcg
caggtctccaacgccgcgttcgacgccgccaccctcgagatctggggtgccctgctcaac
ggcggccacctgatcggcttcgacaaacagaccgtcctgtcaccgccccggctcgcgacc
gccctgcgcgaccacgacatccacaccgtcgtgctggccaccccgctgttcgcgcagctc
accggctacgacccgaagacgttcgccggcacccgccagctgctcgtcggcggcgactcg
atggacccgaaacgagcccgggaggtggccgagctcggtggcccgctgctcaccaacggc
tacgggccgaccgagtccaccaccttcgccaccacccagccgcttcccgtcgtggccgac
gacgtctggcggctcccgatcggcggaccgatcgccaacacccgcgtgtacgtcctggac
gagcagtggaacccggtgccggtgggcgtacccggccagttgttcatcggcggcgacggg
ctgggccgcggttacctcggcaggccggccctgaccgccgagaagttcgtgcccgacccg
ttcagcgacattcccggcagccgcatgtacgccaccggcgatctggcccgctggctgccc
ggcggggtgatcgacttcctcggccggatcgatttccaggtgaaggtccgcggtttccgg
atcgagctcggtgacatcgacgccgcactgacctcccatccgggagtcggtgaggcggtc
accgtggtcgacgagtccacaggcgacaagcgcctcgccgccttctactccggcaccgtg
gaaaccgccgagctgaccgcccacctcaccgagcggctgcccgaatacatggtgcccggc
atcctcgtacggctggacgagctgccgaagaaccccaaccgcaagatcgaccgggcggcg
ctgcgggtgccgaccggcgagggtgccccggtcaccggcggggacggcggatcagacctg
gaaggcgagatcgtcgcgctgctcaccgaggtgctgggccgtgccgacgtcgaccccgac
gacaacttcttcgagatcggcggccattcgctgctggccatccggctactggcccagatc
aaacagacctacggcgtcgatctcgacctgagcgacctgttcacggacccgaccgcccgg
gcggtggccgagcagatcgccgagcgccgcggggccgtccccgaacccgcggcggccacc
ggaccgaccgcggtgtcgcgcgacgcctacgccgcgaggaggccacgatga

DBGET integrated database retrieval system