KEGG   Actinoplanes missouriensis: AMIS_54840Help
Entry
AMIS_54840        CDS       T01795                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00250  Alanine, aspartate and glutamate metabolism
ams00410  beta-Alanine metabolism
ams00640  Propanoate metabolism
ams00650  Butanoate metabolism
ams01100  Metabolic pathways
ams01120  Microbial metabolism in diverse environments
Module
ams_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMIS_54840
   00650 Butanoate metabolism
    AMIS_54840
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMIS_54840
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMIS_54840
Enzymes [BR:ams01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMIS_54840
Amino acid related enzymes [BR:ams01007]
 Aminotransferase (transaminase)
  Class III
   AMIS_54840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Epsilon_antitox
Motif
Other DBs
NCBI-ProteinID: BAL90704
UniProt: I0HCG7
LinkDB All DBs
Position
complement(5843092..5844387)
Genome map
AA seq 431 aa AA seqDB search
MSLLDRHRAVMPGWMPVYYGDDAIEIVSGSGRHVTGADGRTYLDFFGGVLTTMIGYDIAE
ISDAVRRQIGTGVAHTSTLYLIRQQVELAEKIARVSGIPDARVFFTNSGSEANESALLFA
ANVRRSNQILAIKNSYHGRTFATMAVTGHRSWSSSSLSPLTVNWLSSADRLRGRMAGLGA
EDLLDAAVDDLREVLATVTAGDVAALIAEPIQGVGGFVHGPDGLLGAYQKVLAESGILLI
ADEVQTGWGRTGEHFWGYQAHGVTPDLITFAKGIGNGFALGGVVGRAEVMNAVPAISFST
FGGNPVSAAAGNAVLDYVLDHDLQGNAQRVGSILLGGLRSLDAAIVGEVRGRGLMIGIEF
VRPGTTEPDPAATLRVFDRCREGGLLVGKGGLHGNVIRIGPPLTLTEEEARTGLSVLTDA
ITATDAEAHIS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctggatcggcaccgagcggtcatgcccggctggatgccggtgtactacggc
gacgacgcgatcgagatcgtgtccggaagtggtcgtcacgtcacgggagctgacgggcgc
acgtacctggacttcttcggcggggtcctgaccacgatgatcggttacgacatcgccgag
atcagcgacgcggtccgccgccagatcggcaccggcgtcgcgcacacctccacgctctac
ctgatccgccagcaggtcgagctcgccgagaagatcgcccgggtctccggcatcccggac
gcgcgggtcttcttcaccaactccgggtccgaggcgaacgagtcggcgctgctcttcgcc
gcgaacgtgcgccgctccaaccagatcctggcgatcaagaacagctatcacggccggacg
ttcgccacgatggcggtgaccggccaccggagctggtcgtcgagctcgctcagcccgctc
acggtgaactggctgtcgtccgccgaccggctgcgcggtcggatggccgggctcggcgcc
gaggacctgctcgacgcggccgtcgacgacctgcgcgaggtgctcgccacggtcaccgcc
ggggacgtggcggcgctgatcgccgagccgatccagggtgtcggcgggttcgtccacggg
ccggacgggctgctcggcgcgtaccagaaggtcctcgccgaatccggcatcctgctgatc
gccgatgaggtgcagaccggctggggccgcaccggcgagcacttctgggggtaccaggcg
cacggcgtcaccccggatctgatcacgttcgccaaggggatcggcaacgggttcgcgctc
ggcggcgtggtcggccgggccgaggtgatgaacgcggtgccggcgatcagcttctccacg
ttcggcggcaacccggtcagcgcggcggccggcaacgcggtgctcgactacgtcctcgac
cacgacctgcagggcaacgcgcagcgggtcggatcgatcctgctcggcgggctgcgctcg
ctggacgcggcgatcgtgggcgaggtgcgcgggcgcgggctgatgatcggcatcgagttc
gtccgtcccggcaccaccgagccggacccggccgccacgttgcgggtcttcgatcggtgc
cgggagggcggtctgctggtcggcaagggcggcctccacggcaacgtgatccggatcggc
ccgccactcactctgaccgaggaggaggcccgcacgggcctttccgtgctgaccgacgcg
atcaccgcgaccgacgcggaagcgcatatctcctga

DBGET integrated database retrieval system