KEGG   Alkaliphilus metalliredigens: Amet_0511Help
Entry
Amet_0511         CDS       T00551                                 

Definition
(GenBank) Catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Amet_0511
  Amino acid metabolism
   00380 Tryptophan metabolism
    Amet_0511
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Amet_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(531217..533358)
Genome map
AA seq 713 aa AA seqDB search
MNTGPQQPQNTMEQNSKNEKLDLHRVDHNNELLTTNQGGRVSNTDDSLKAGARGPTLMED
FHFREKMTHFDHERIPERVVHARGFGVHGYFQVYEPMAELTKAKFLQDPTKKTPVFVRFS
TVVGSKGSADTVRDVRGFATKFYTEDGNYDLVSNNIPVFFIQDAIKFPDVVHAIKPEPHN
EIPQASAAHDTFWDFVVNTPETAHMIMWLLSDRAIPRSFRMMEGFGVNTFRFVNEQGKAR
FVKFHWKPLLGVHSLVWDEAQKLAGKDPDYHRRDLWDAIDMGEYPEYELGVQIVEEEEEF
NFDFDILDATKIWPEEMIPVKRIGKMTLDNNVANFFAETEQVAFHPGHVVPGIDFSNDPL
LQGRLFSYLDTQLIRLGGPNFHEIPINRPMAPIHNNQRDGYHRMTIDRGRVSYSPNSLQN
DAPHPAPEADHGYVHHAEKVEGQKVRERSESFRDHYRQATLFWNSMSSAEKQHIIEAFHF
EVGSVMDKQIKQRVVNMFNNVDGQLATQIAVGVGADSPAALGGNGVTATSPAVSQENTVK
DARTRKVAILLENGFNYPEVTQVMSAFNGAGVHTEIVSKNLGMLTSVDGQQLEVGKNYAT
TASIKYDAVYVPGGPQSINSLMMQGDALHFVNEAFKHAKAIGATNEGVDLLMASAIQGVN
MAGGNTQDQLITEMGVVTVRNVTDTNQFSQEFTNAIAQHRHWSRQNKKQMIPA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaggaccacaacagcctcaaaataccatggaacaaaacagtaaaaatgagaaa
ttagatttgcatcgtgtagatcataacaatgaattgcttacaacaaatcaagggggacgg
gtctctaatactgacgattccctcaaggcaggtgcccggggtccaacgttaatggaggat
tttcatttcagagagaaaatgactcattttgatcacgagcgcattccagagcgtgttgtc
catgcccgtggatttggtgtccatggctactttcaagtttatgaaccaatggccgaactt
actaaggctaaattcctacaggatccaacaaaaaaaacaccagtattcgtgcgtttttca
acagtggtaggttctaagggttcagccgataccgtccgggatgtgaggggttttgccact
aagttttataccgaagacggcaattatgaccttgtctccaataacattcctgtgttcttt
attcaggatgcaattaaattcccagatgtagttcatgccattaagccagagcctcataat
gaaattccacaggcttctgccgcccacgataccttttgggacttcgttgtcaatacccca
gagactgcccatatgattatgtggctactctcagatcgagctattccacgaagcttcaga
atgatggaaggctttggcgtcaatacctttcgatttgtaaatgaacagggcaaggcacgg
tttgtgaagttccattggaagcccttgttgggtgtccattccctggtttgggatgaagcc
caaaagctggcaggaaaggatccagattatcatagacgggatttatgggatgcaattgac
atgggagaatatccagaatatgagctgggggtacaaatagtagaggaggaggaggaattc
aatttcgattttgatatccttgatgccactaagatttggcctgaggaaatgatccccgtt
aaacgaatcggtaagatgaccttggataataatgtggccaacttttttgcagagacggag
caagtggcattccatcctggccatgtggtgccagggattgattttagtaatgacccctta
ttacagggtaggttattttcctacttagatacgcagctcatccgtttgggtggccctaac
ttccatgagatccccattaaccgacccatggcccctatacataataatcagcgggatggc
tatcatcgtatgaccatagaccgtggccgggttagctattcaccaaactccctccaaaat
gatgcacctcatccagctcccgaagctgatcatggctatgttcatcatgcagagaaggtc
gagggtcaaaaggttcgtgagcgtagtgagagctttagagatcattatagacaagcaacc
cttttctggaatagtatgtctagtgcagaaaagcaacatatcatcgaagccttccacttc
gaggtgggaagcgttatggataaacaaattaaacagcgggtcgtgaacatgtttaacaat
gtagatggacagctggccacacaaattgcagttggtgtgggggcagattcaccagcagcc
ctaggtggaaatggcgtcacagccacctcaccagccgtaagccaggagaataccgtcaag
gatgctcggactagaaaggttgccatattattagaaaatggatttaattatccagaagta
acccaggtaatgtctgccttcaatggcgccggcgtccatacagaaattgtcagtaaaaac
ctgggcatgctgacaagtgttgatggccagcagttggaagtaggtaaaaattatgcaacc
actgcatctatcaaatacgatgcggtttacgtacctggaggtccacaaagcatcaacagt
ttaatgatgcagggtgatgcattgcattttgtcaacgaagcctttaagcatgctaaagca
atcggagccacaaatgaaggcgttgatctgttgatggcctctgctattcaaggggtcaat
atggctggtggcaatacacaggatcaactcattacagaaatgggcgtcgtcacagttcga
aatgtgacagacaccaatcaattcagccaggaattcaccaatgccatcgctcagcatcgt
cattggagtcgtcagaacaaaaaacaaatgatccctgcttag

DBGET integrated database retrieval system