KEGG   Akkermansia muciniphila: Amuc_0290Help
Entry
Amuc_0290         CDS       T00736                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amu  Akkermansia muciniphila
Pathway
amu00052  Galactose metabolism
amu00511  Other glycan degradation
amu00600  Sphingolipid metabolism
amu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amuc_0290
  Lipid metabolism
   00600 Sphingolipid metabolism
    Amuc_0290
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Amuc_0290
Enzymes [BR:amu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Amuc_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 F5_F8_type_C Glyco_hydro_2_N Glyco_hydro_2 XRCC1_N Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ACD04132
JGI: Amuc0290
UniProt: B2UMS6
LinkDB All DBs
Position
347442..350402
Genome map
AA seq 986 aa AA seqDB search
MFTNITRTTLCITAFSIASLMAAPLNATKTESLDWNWKFARFGKMPDGSTQPEPGKAMGF
ATATSEESGNPADNAVDGDKSTRWCAASGKSGEKITVDMGRPVDVKTVNILWEKQSNHLF
KLEGSGDGKRWATIEDKTSGQNDSKEDTVENKTGKPRYFRITVTGNNQSNWASIREITFK
NDKGEIIRPQAAAGTSKADNPSSPSFNDKNWRSLNLPHDWGVEGPFRMEIENRTGKLPWV
GIGWYRKTLEIPADAKGNQFYLDFDGVMSRPKIYVNGHLAGEWKYGYSSFRVDITPFLKF
GQQNTIAVRVDNPPSTSRWYPGGGIYRHVWLTESNPVHIEHWGVFVKTPEITKSAAKVEV
DTTVKNTTDKAVIPTVTEEILDGGKIVASTTTKGEEIPAGEKGKITSTLTLKNPTLWTLN
APHLYKMKTTVRMGDKVIDQKFTNFGVRTVEWKPTGFYLNGERVQLKGVCQHHDLGPLGS
AAHTRGYERQIEILKEFGVNSIRTSHNPPAPEVLDLCDKMGILVIDELFDVWQCSKEGVN
NESFNEWHERDVVNLCHRDRNHPCVIAWSSGNEVPEQGMKNLHHISQTLTDLFHREDPTR
KVTSGCNNANAARNGFGDTLDVYGYNYKPWAYKDFAKDRPHQPFYGAETASCVSSRGEYF
FPVDWNKGKGFYLYQVSSYDLYAPGWANRPDVEFAAQEDNPNSAGEYVWTGFDYIGEPTP
YNLDATNALNVPEGPEREKLMAELKKLGDRAPSRSSYFGIVDLCGFKKDRFYIYQAHWRP
DLKMAHILPHWNWPERKGQVTPVHVYTSGDEAELFLNGKSQGVRKKGTGEKDRYRLVWED
VKYTPGTLKVVAKKDGKIWATDTVTTTGKPAALTLKPDRNEIKGDGYDLSYVTVAVRDAQ
GRMVPRSKNQLTFKVSGPADIAGICNGDPTDFTTMANPENKKIMKIKAFNGLAQVILRSR
KGESGKVTLQVISNGLKPAQTTVTVK
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaatattacacgcacgaccctctgcattactgcgttcagcatcgccagcctc
atggcggcgcctctgaatgcaaccaaaacggagagcctggattggaactggaaattcgcc
cgtttcgggaaaatgccggatggcagtacgcaaccggaaccgggaaaagccatgggattc
gccactgccaccagtgaagaatccggcaatccggcggacaatgccgtggacggggacaag
tccacccgctggtgtgccgccagtggcaaaagcggagaaaaaatcaccgtggacatggga
cgccccgtagatgtaaaaaccgttaacatcctgtgggaaaaacaaagcaaccatcttttc
aagctggaaggctccggtgacggaaaacgctgggcaactattgaagacaaaacttccggg
caaaacgactccaaggaagacacggtagaaaacaaaaccggcaaaccgcgatacttccgc
atcaccgtcacgggcaacaaccagagcaactgggccagcatccgtgaaatcacctttaaa
aacgacaagggggaaattatccgccctcaggccgccgccggaaccagtaaggcggacaat
ccctccagcccctctttcaacgacaaaaactggcgttccttgaacctgccgcacgactgg
ggcgtggaaggacccttccggatggaaattgaaaacagaaccggaaaactcccctgggtc
ggcattggctggtaccgcaaaacgctggaaatcccggcggacgccaagggcaaccaattc
tatctggactttgacggcgttatgtcccgccccaaaatttatgtgaacggacacctggcc
ggcgaatggaaatacggttacagctccttccgcgtggacatcacgcccttcctgaaattc
gggcagcaaaataccattgccgtcagagtggacaatccccccagcacctcccgatggtat
ccgggcggcggcatctaccgccatgtgtggctcacggaatccaaccctgtgcacatcgaa
cactggggcgttttcgtcaaaactccggaaatcaccaaatccgccgccaaggtagaagtg
gacaccacggtgaaaaacaccacggacaaagccgtcatccccactgttactgaagaaatc
ctggacggaggtaaaatcgtagcctccacaaccaccaaaggggaagaaattcccgccggg
gaaaagggcaaaatcaccagtacgctgacgctcaaaaaccccactctgtggacgctaaac
gctccccatctgtataagatgaaaaccacggtcaggatgggagacaaagtcatagaccaa
aaattcaccaacttcggcgtaagaaccgttgaatggaaacccacgggattctaccttaac
ggggagcgcgtgcagctcaagggcgtttgccagcaccatgacctgggaccgctcggctcc
gccgcccacacgcgaggctatgaacgccagattgaaatcctgaaggaattcggcgtcaac
tccatccgcacgtcccacaacccgcctgcgccggaagtgctggacctgtgcgataaaatg
ggcatcctggtcattgacgaacttttcgacgtatggcaatgctccaaagaaggcgtcaac
aacgaatcctttaacgaatggcatgaacgggacgtggttaacctctgccaccgggaccga
aaccacccctgtgtcattgcatggagttcgggaaatgaagttccggaacagggaatgaaa
aatctgcaccatatctcccaaaccctgacggatcttttccaccgggaagaccccacgcgt
aaagtgacttccggctgcaacaacgccaatgccgcacgcaacggctttggggacaccctg
gatgtttacggctataactacaagccctgggcctacaaggacttcgccaaggaccgcccc
caccagccgttctatggtgcggaaaccgcctcctgtgtcagctcccgcggagaatacttc
ttccccgtggactggaacaaaggcaagggattctacctctaccaggtcagttcctatgac
ctgtacgcccccggctgggccaaccgtccggatgtggaattcgccgctcaggaagacaat
cccaacagcgcgggagaatatgtatggacgggctttgactacattggggaacccaccccg
tacaatctggacgccaccaacgccctgaacgtgccggaagggccggaacgcgaaaagctg
atggcggaactcaaaaaactgggagaccgcgccccctcccgcagctcctacttcggcatc
gtggacctgtgcggcttcaaaaaggaccgcttctacatctaccaggcccactggaggccg
gatctcaagatggcgcacatcctgccgcactggaactggccggaacgcaaggggcaggta
acgcccgtgcatgtctacaccagcggggatgaagcggaactcttcctgaatgggaaatcc
cagggcgtccgcaaaaagggcaccggggaaaaggaccgctaccgcctcgtgtgggaagac
gttaaatacacgcccggcaccctcaaagtagtcgccaaaaaggacggtaaaatctgggct
acggacacggtaaccactaccggaaaacctgcggcgctcaccctcaagccggaccgcaat
gaaatcaagggagacggctatgacctgtcttatgtcaccgtagccgtccgcgacgcccag
ggccgtatggtgccccgaagcaaaaaccagctcaccttcaaggtaagcggccccgcggac
atcgccggcatctgcaacggtgatcccacggacttcaccaccatggcgaatccggaaaac
aagaaaatcatgaaaatcaaggccttcaatggtcttgcccaggtcattctgcgctcccgc
aagggagaatccggaaaagtgacgctccaagtcatctccaacggactcaagccggctcag
acaactgtgacggtcaaataa

DBGET integrated database retrieval system