KEGG   Altererythrobacter marensis: AM2010_2032Help
Entry
AM2010_2032       CDS       T03951                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
amx  Altererythrobacter marensis
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amx00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AM2010_2032
Enzymes [BR:amx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AM2010_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2168674..2169891)
Genome map
AA seq 405 aa AA seqDB search
MLAQARARDAADPLREYRAHFALPEGVIYLDGNSLGVLPKATAGRMAGVVRGEWGEGLIR
SWNSADWIGLPRRVGGRIAPLVGAAPDTVIACDSTSINLFKLIAAALAMRPGRKVVLSEP
GNFPTDLYMIAGLEAQGLAERRLAPRDRIADALDGDVALLLLTHVHYKTGEVFDMAALTR
AAHEAGALVLWDLSHSAGAIPVELDGCGADFAVGCGYKYLNGGPGAPAFAYVAQRHHAAL
EQPLTGWMGHAAPFAFSDDYQPAPGVGRLLCGTPPILGLSALEVGVDLVAEIGIERLAAK
SRALSEFFRTCLDQAGVALELVSPPDPMQRGSQLSFRHPEAYAICQALIARGVIGDFRDP
DILRFGFAPAYVSFEDVAEAVRHLAEVLETGEWQRDEFRERAAVT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctggcacaggcgcgcgcccgcgatgccgccgatcccctgcgcgaatatcgcgcgcac
ttcgccctgcccgaaggggtgatctacctcgacggcaattcgctcggcgtcctgccgaaa
gcgacggcgggccgcatggccggcgtcgtgcgcggcgaatggggcgaagggttgatccgc
agctggaatagcgccgactggatcggcctgccccggcgcgtgggcggcaggatcgccccg
ctggtcggggccgcgccggacacggtgatcgcctgcgacagcaccagcatcaatctgttc
aagctgatcgccgccgcgctcgccatgcggccggggcgcaaggtcgtcctgtccgaaccg
ggcaatttcccgaccgacctctacatgatcgccgggctggaggcgcagggcctcgccgaa
cgccgcctcgccccgcgcgaccggattgccgatgcgctggacggcgacgtcgcgctgctg
ctgctgacccacgtgcattacaagaccggcgaggtgttcgacatggccgcgctgacccgc
gccgcgcacgaggccggggcgctggtcctgtgggacctgtcgcatagtgccggcgcgatc
ccggtcgaacttgacgggtgcggggccgatttcgcggtcggctgtggctacaagtatctg
aacggcggccccggcgcgccggccttcgcttatgtcgcgcagcgccatcatgccgcgctg
gaacagccgctgaccggctggatgggccatgccgcaccgttcgccttctccgacgactac
cagcccgcgcccggcgtcggccggctgctgtgtggcacgccgccgatcctgggcctttcg
gcgctggaggtgggggtggacctggttgcggagatcggcatcgaacgcctcgccgcaaaa
tcgcgcgcgctgtccgaattcttccgtacctgcctcgaccaggcaggcgtcgctctcgaa
ctcgtcagcccgcccgatcccatgcagcgcggcagccagctctccttccgccacccggaa
gcatacgcgatctgccaggccctcatcgcccgcggcgtgatcggcgatttccgcgatccc
gacatcctacgcttcggctttgccccggcctacgtctccttcgaagacgtggcggaggcc
gtccggcacctggccgaagtgctcgaaaccggcgaatggcagcgcgacgagtttcgcgag
agggcggcggttacctga

DBGET integrated database retrieval system