KEGG   Actinomyces meyeri: ADJ76_01845Help
Entry
ADJ76_01845       CDS       T04027                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
amy  Actinomyces meyeri
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ADJ76_01845
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ADJ76_01845
Enzymes [BR:amy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ADJ76_01845
Bacterial toxins [BR:amy02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ADJ76_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
414535..416661
Genome map
AA seq 708 aa AA seqDB search
MTLRHYGRALAAVSGAVLLCASLAAPALAAPDNDTATTDTTTASETQESSAPITVTATRT
DSNGDKVYAGDVITVTFTYTNETDSALTAFPTESNLSGVLPPNAPNCRWHNLPAHTTKQC
TSASHTVTAEDVAAGSFTPTSTWAATRDREGKDVIAGNITANAAPIAVGEGSRPPEPDPL
ETPRDYAIGEKARLASPGSAGFSCHRIPALTTAPNGWILAAWDGRPDTCKDAPQANSIVY
RISKDGGKSWTPINTAIAGTPGANKVGYSDPSFVVDRSTGTIFLFSVKSYDAGLFQSQLG
TDPAARNILHAHVIESHDNGLTWENPRTITDQVTQGHESEWSTRFASSGEGIQLRYGAHA
GRLIQQYAVAKSGSNSLMAVSVYSDDHGATWKPGAATEGSADENKVVELSDGRLLLNSRT
QGTAGQRLESISYDGGQTWGPFRHNWDLKDPRNNASITRAYPDAPKGSARARVLLFSNAN
SDKERANGTVRISYDDGFTWNEGKVFEKGAMAYSTLHALSDGTWGLLYESEDYKNIEFTR
LDAAYLGLVDPGEGPAPEDPGPSKTPPHWVNTGNGWKWQLEDSSFATSQTLTIGNATYRF
DANGFMVTGWDKQDGKWSYFNAYGARVSGWLLDAGTWYYLDPDTGVMVTGWAQVDGSWYY
LDASGAMVTGWLQLGGTWYYLASDGHMVTGWHMIDGRWYRFSPSGAWI
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccgtcactatgggcgagccctcgcggcagtctcgggagccgtgctgctgtgc
gcctccctggccgctcccgcgctggccgcccccgacaacgacaccgctaccacagacacc
accacggcctcggaaacccaagaaagttcggccccgatcaccgtcaccgccacccgcacc
gactccaacggcgacaaggtgtacgccggtgacgtcattaccgtcacttttacctacacc
aacgaaaccgacagcgcgctcaccgccttcccgacggagtccaacttgtccggcgtgctg
ccccccaacgcccccaactgccggtggcacaacctgcccgcgcacaccaccaagcagtgc
acgagcgccagccacacggtgaccgccgaggacgttgcggccggatcctttacccccacc
tccacgtgggcggccacccgcgaccgtgaaggcaaggacgtcatcgccgggaacatcacg
gccaacgccgctccgatcgccgtcggcgaaggaagccgacccccggagcccgacccgctc
gaaacccctcgcgactacgccatcggtgaaaaggctcgcctggcttcccctggaagcgcc
ggattcagttgccaccgcatccccgcgctgaccacggcccccaatggctggatcctcgcc
gcgtgggatgggcgccccgacacctgcaaggacgccccccaggccaactccatcgtctac
cgtatctccaaggatggcggaaagtcctggacccccatcaatacggctatcgcaggcacg
cccggagcgaacaaggtcggatactccgacccgtccttcgtcgttgatcgctcgaccgga
acgattttcctcttctctgtcaagtcctacgacgcgggtctcttccaatcccagctgggc
accgatcccgccgcccgcaacatcctgcacgctcacgtgattgagtcccacgacaacggc
ctcacctgggagaacccccgcaccatcaccgaccaggtgacgcagggacacgaaagcgag
tggtccacgcgcttcgcctcctccggtgaggggatccagctgcgctacggcgcccacgcc
ggtcgactcatccagcagtacgccgtcgccaaatccggcagcaattccctgatggccgtc
tccgtctactccgacgaccacggcgccacgtggaagcccggcgccgccacggaaggcagc
gccgacgagaacaaggtcgtcgagctgtccgacggccgcctgctgctcaactcgcgcacg
cagggcacggccggccagcgcctggagtcgatctcttatgacggcggccaaacctggggt
cccttccgccacaactgggacctgaaggatccgcgcaataacgcctccatcacgcgcgcc
tacccggacgcccccaagggttccgcgcgtgcccgcgtcctgctcttctctaatgccaat
tccgacaaagaacgcgcgaacggaacagtccgcatctcctacgatgacggcttcacctgg
aacgagggcaaggtattcgagaagggcgcgatggcctactcgaccctgcacgccctcagc
gatggaacctggggtctcctctacgagtccgaggactacaagaacatcgaatttacgcgc
ctcgacgccgcctacctgggcctcgtcgatcccggggaggggccagcgccggaggatccc
ggtccctcgaagacccctccgcactgggtcaacaccggcaacggatggaagtggcagctg
gaagactcgtccttcgcgacctcccagaccctcaccattggtaacgccacctaccgcttc
gacgccaacggcttcatggtcaccggctgggataagcaggacggcaagtggagctacttc
aacgcctacggcgctcgcgtcagcggctggctcctggacgcaggcacctggtactacctg
gaccccgacacgggtgtcatggttaccggctgggcgcaggtcgacggtagctggtactac
ctggacgcctccggcgcgatggtcaccggttggctgcagctcggaggtacctggtactac
ctcgcctctgacggtcacatggtcaccggttggcatatgatcgacggacgctggtaccgc
ttctcgccctcgggtgcgtggatctga

DBGET integrated database retrieval system