KEGG   Actinomyces meyeri: ADJ76_06865Help
Entry
ADJ76_06865       CDS       T04027                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
amy  Actinomyces meyeri
Brite
Enzymes [BR:amy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ADJ76_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1580826..1581467
Genome map
AA seq 213 aa AA seqDB search
MTAYTLPDLPYDYSALEPHISGRIMELHHDKHHAAYVAGANAALDKLAAAREAGDFGAIN
LWEKNLAFNLGGHTNHSIFWTNMTGEGASRPAGELADAINEFFGSFEAFQAQFAAAALGL
QGSGWAVLAWDSIAERLVTFQLTDQQGNTPVATLPLLMIDMWEHAFYLDYLNVKANYVKA
WWNLVNWENVASRFNTARLSSGLVNAPAGLPNS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctataccctgcccgatctcccctacgactactccgcgcttgagccccatatc
tccgggcgcatcatggagctgcaccacgataagcaccatgccgcgtacgtggccggggca
aacgccgcgctggacaagctggccgcagcacgcgaggccggtgatttcggagccatcaac
ctgtgggaaaagaacctggccttcaacctgggcggccacacgaaccactcgatcttctgg
accaacatgaccggtgagggcgcgtcccgccccgcgggagagctcgcggacgcgatcaac
gagttcttcggctccttcgaggccttccaggcgcagttcgcggccgccgccctgggcctg
cagggctccggctgggccgtcctcgcgtgggacagcatcgccgagcgcctggtgaccttc
cagctgaccgaccagcagggcaacacccccgtcgcaacccttcccctgctcatgatcgac
atgtgggagcacgccttctacctggattacctcaacgtcaaggccaactacgtgaaggcc
tggtggaacctggttaactgggaaaacgtcgcgtcccgcttcaacactgcccgcctatcc
tccggcctggtgaacgcgcccgcgggcttgccgaactcatag

DBGET integrated database retrieval system