KEGG   Amycolatopsis mediterranei RB: B737_4100Help
Entry
B737_4100         CDS       T02804                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
amz  Amycolatopsis mediterranei RB
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4563053..4564117
Genome map
AA seq 354 aa AA seqDB search
MPPVRPMLAKAVHEVPRDPGLLYEPKWDGFRCVVFRDGDEIELGSRNDRPLTRYFPELVE
LLAAALPPRCVVDGEIVLVTPAGLDFEVLQLRLHPAASRVRKLAEETPASFIAFDLLALG
DTDLTEEPFRERRKQLESVLSTAAEGLQRVHLTPLSDDPAQAEDWFTRFEGAGFDGVMAK
PGDLPYEQDKRVMLKVKHERTADCVVTGFRWHKDGAGVGSLLLGLFDDEGVLHHVGVASS
FTKARRAELVDELAPLRENALEGHPWRNWAEYEPQPGRQPGANSRWAPQKDLSWEPLRPE
WVAEVRYEHLQGGRFRHGGRLVRFRPDRTPESCTYAQLDEAPPAELAKLLGEAR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgcggccgatgctcgcgaaagccgtgcacgaggtgcctcgtgacccgggg
ctgctgtacgagcccaagtgggacgggttccgctgcgtcgtgttccgcgacggcgacgag
atcgaactcggctcccgcaacgaccgcccgctgacccgctacttcccggagctggtggag
ctgctggccgccgcgctgccgccccgctgcgtcgtggacggcgagatcgtgctggtcacg
ccggccgggctcgacttcgaggtgctgcagctgcggctgcacccggcggcttcccgcgtg
cgcaagctcgccgaggagacgccggccagcttcatcgccttcgacctgctcgccctcggc
gacaccgatctcaccgaggagccgttccgcgagcggcgcaagcagctcgaaagcgtgctg
tccacggccgccgaagggctgcagcgcgtccacctgaccccgctgagcgacgatccggcg
caggcggaggactggttcacccggttcgagggcgcgggcttcgacggcgtcatggccaag
cccggcgacctgccgtacgagcaggacaagcgcgtcatgctgaaggtcaagcacgagcgc
acggccgactgcgtcgtcaccggcttccgctggcacaaggacggcgccggcgtcggttcg
ctgctgctcgggctgttcgacgacgagggtgtcctgcaccacgtcggcgtggccagcagc
ttcaccaaggcgcggcgggccgagctggtcgacgagctggcgccgctgcgcgagaacgcg
ctcgaaggccatccgtggcgcaactgggccgagtacgaaccgcagcccggtcgccagccg
ggcgccaacagccggtgggcgccgcagaaggacctctcgtgggagccgctgcgcccggaa
tgggtggcggaggtccgctacgagcacctgcagggcggccggttccggcacggcgggcgg
ctggtccgcttccggcccgaccgcaccccggagtcctgcacgtacgcccagctcgacgag
gcaccgcccgccgagctcgcgaagctgttgggggaggcgcggtga

DBGET integrated database retrieval system