KEGG   Amycolatopsis mediterranei RB: B737_4101Help
Entry
B737_4101         CDS       T02804                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
amz  Amycolatopsis mediterranei RB
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4564114..4565118
Genome map
AA seq 334 aa AA seqDB search
MSGAVLLDVDGVEVKISSPDKVYFPERGETKLDLVEYYRAISGPLLARLGGRPLLLERYP
DGAGGKNWFQKRVPKGTPPWLTTTVVSTPNGTTSDALVAKDLAHLLWAVNLGCLGFHVWP
YLADTPEVTDELRVDLDPSPGIGFDELREAAVLTREFLAEHGIEGHLKTSGSRGLHLYVL
LEPRWDSFQVRAAAVALARALERRHPEKITAQWWKEERGSRVFVDFNQNAPHKTVFGTWC
VRPRVGGQVSTPIGWDELDTVEPDTLTLSTVPARVAERGDPWAGAGERPQSIEPLLAMSE
RDMADGLMDAPWPPVYPKMPNEPPRVAPSRAKKA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggcggtcctgctcgacgtcgacggcgtcgaggtcaagatcagcagtccggac
aaggtctacttcccggaacgcggggagacgaagctcgacctcgtcgagtactaccgggcg
atttccgggccgctgctggcccggctcggcgggcgtccgctgctgctggagcgctacccg
gacggcgccggcggcaagaactggttccagaaacgcgtcccgaagggcacgccgccgtgg
ctgaccaccacggtcgtctcgacgccgaacggcacgacgagcgacgcgctggtggcgaag
gacctcgcccacctcctctgggcggtgaacctcggctgcctcggcttccacgtctggccc
tacctcgccgacacgcccgaggtcaccgacgaactgcgcgtcgacctcgacccgtcgccc
ggcatcggcttcgacgagctgcgcgaagccgcggtgctgaccagggagttcctggccgaa
cacggcatcgagggccacctgaagacgtcgggttcgcgcgggctgcacctctacgtgctg
ctcgagccgcgctgggacagcttccaggtgcgggcggccgcggtcgcgctggcgcgggcc
ctcgaacgccggcacccggagaagatcaccgcgcagtggtggaaggaagaacgcggctcg
cgcgtgttcgtcgacttcaaccagaacgccccgcacaagaccgtgttcggcacctggtgc
gtgcgcccgcgggtcggcggccaggtgtccaccccgatcggctgggacgagctggacacc
gtcgagcccgacacgctgacgctgagcacggtgccggcgcgggtcgccgagcgcggcgat
ccgtgggccggggcgggggagcggccgcagtcgatcgagccgctgctggcgatgtccgaa
cgcgacatggcggacgggctgatggacgcgccgtggccgccggtgtacccgaagatgccc
aacgagccgcctcgggtggcgccgagccgcgcgaagaaggcgtga

DBGET integrated database retrieval system