KEGG   Amycolatopsis mediterranei RB: B737_4147Help
Entry
B737_4147         CDS       T02804                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:amz00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    B737_4147 (lig)
Enzymes [BR:amz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B737_4147 (lig)
DNA repair and recombination proteins [BR:amz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B737_4147 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4616811..4617710
Genome map
AA seq 299 aa AA seqDB search
MQVGERRLTLSNLEKVLYPRPGFTKGEVLDYYTRIAPVLLPHVRDRAMTFVRFPEGVTGT
SFFEKDVSRHAPDWVRTARLTVGGRGKEPEIVAYPLINDLPELVWAANLAALELHVHQWT
VGPGDERSTPDRLVFDLDPGPGATVVDCCRVAERLHDVLVEDGLTPVAKTSGSKGMQLYA
GIVTTDGGEPSQYAKALAERLAAETPDLVVARMTKNLRPGKVFIDWSQNNPFKTTVAPYS
LRGRDEPTVSAPVTWDEVRACRHVTHLRFTAGEVLARVEDIGDLFADLERTRVPILAFG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcggcgagcgccggctgacgctgtcgaacctcgagaaggtgctctacccgcgg
cccggcttcaccaagggcgaggtgctcgactactacacgcggatcgcgccggttttgctg
ccgcacgtgcgcgaccgggcgatgacgttcgtgcggttccccgagggcgtcaccggcacc
tcgttcttcgagaaggacgtctcccggcacgcgccggactgggtccgcaccgcgcgcctg
accgtcggcggccgcggcaaggagcccgagatcgtcgcgtacccgctgatcaacgacctg
cccgagctcgtctgggcggccaacctcgccgccctcgaactgcacgtccaccagtggacc
gtcgggcccggcgacgagcgcagcaccccggaccggctggtgttcgacctcgacccggga
cccggcgcgacggttgtcgactgctgccgggtcgccgaacggctccacgacgtcctcgtc
gaggacgggctcaccccggttgcgaagaccagcggctccaaaggcatgcagctgtacgcg
ggcatcgtgacgacggacggcggtgagccgtcgcagtacgccaaggcgctggccgagcgg
ctcgccgccgagacgccggacctcgtcgtggcgcggatgacgaagaacctgcgcccgggc
aaggtcttcatcgactggagccagaacaacccgttcaagaccacggtggcgccgtactcg
ctgcgcgggcgcgacgagccgacggtctcggctccggtcacgtgggacgaggtccgcgct
tgccggcacgtcacgcacctcaggttcaccgcgggcgaagtcctggcgcgcgtcgaggac
atcggagatctgttcgccgatctggaacgcacccgcgtcccgattttggcgttcggctga

DBGET integrated database retrieval system