KEGG   Amycolatopsis mediterranei RB: B737_7831Help
Entry
B737_7831         CDS       T02804                                 

Gene name
kgd
Definition
(GenBank) 2-oxoglutarate decarboxylase
  KO
K01616  
2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
amz  Amycolatopsis mediterranei RB
Brite
Enzymes [BR:amz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     B737_7831 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
8756140..8759790
Genome map
AA seq 1216 aa AA seqDB search
MYDQFLADPSSVDAAWHDFFADFKPTQSAQAKADTARQQQAGAKPAANGQAAQPSAKAVQ
NAESAAKQSSTAPAAKPAPAKAAPKQAPKPAAKAEPKAEAKKEEPESKQLRGAAAAIAKN
MDASLSVPTATSVRAVPAKLMADNRIVINNHLKRTRGGKISFTHLIGYAMVRALKAYPNM
NRHYQLIDGKPFAITPEHVNFGLAIDMKGKDGSRTLVVASIKGCEDMSFLQFWQAYEDIV
KKARNNKLTADDFSGTTISLTNPGGIGTNHSVPRLQAGQGAIIGVGAMQYPAAFEGTSEK
TLVDLGISKIMTLTSTYDHRIIQGAESGEFLKRIHQLLLGEDGFYDDVFTSLRLPYEPIR
WVADIPDGPVDKTARVIELIDAFRMRGHLMADTDPLNYRQRSHADLDVLSHGLTLWDLDR
EFPVGGFAGQERMKLRDILGVLRNSYCRTVGIEYTHILDPEERRWIQERVEIPHEKPDPA
VQKYVLSKLNAAEAFETFLQTKYVGQKRFSLEGGETAIPLLDTILDKAAEHELDEVVIGM
PHRGRLNVLANIVGKPISQIFQEFEGNLDPGQAHGSGDVKYHLGAEGKYFRMFGDGETKV
SLTANPSHLETVDPVLEGIVRAKQDILDKGGEGYTVLPVLMHGDAAFAGQGVVAETLNLS
LLRGYRTGGTVHVIVNNQVGFTTAPEHSRSSQYATDVAKMIGSPIFHVNGDDPEAAHWVA
KLAVEYRQAFHKDVVIDLICYRRRGHNEGDDPSMTQPAMYDIIDTKRSVRKTYTESLIGR
GDISVEEAEAALRDFSSQLEHVFNEVRELEKHPAKASPSVEEEQQVPAKVATAITGKTLE
HIGDAFVNVPDGFTPHPRVKPVMERRHKMSREGDIDWAFGELLAFGSLAMEGRLVRLSGQ
DSRRGTFTQRHSVFIDRKTGQEYSPLQNLADGQGRVMIYDSALSEYAAVGFEYGYSVANP
ESLVMWEAQFGDFVNGAQTVIDEYISSGEAKWGQRSDVVLLLPHGHEGQGPDHTSGRIER
FLSLCAEGSMTVAVPSTPANYFHLLRRHALDGIQRPLVVFTPKSMLRNKAATSPTEDFTG
ESRFMSVIDDVTPDPAKIRKVLLTSGKLYWELVAERTKREADDVAIVRIEQYYPLPKKKL
LAALERYTNATQVAWVQEEPENQGAWPFFGLNLPRKFPEVLSGLQVVSRRPMAAPSAGSS
KVHEVEQKALIAKAFD
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaccagttcctcgcagacccttcttcagtcgatgccgcctggcacgacttcttc
gcggacttcaagccgacgcagagcgcgcaggccaaggcggacaccgcccggcagcagcag
gccggagccaagccggcggccaacggccaggcggcgcagccctcggccaaggccgtgcag
aacgcggagtcggcggccaagcagtcgtcgacggcgccggccgccaagccggcccccgcg
aaggcggccccgaagcaggcgccgaagccggccgcgaaggccgagcccaaggccgaagcg
aagaaggaagagccggagtcgaagcagctgcgcggcgccgcggcggccatcgccaagaac
atggacgcctcgctgagcgtccccaccgcgaccagcgtgcgcgcggtcccggcgaagctg
atggcggacaaccgcatcgtcatcaacaaccacctcaagcgcacccgcggcggcaagatc
tccttcacgcacctcatcggctacgccatggtgcgggcgctgaaggcgtacccgaacatg
aaccggcactaccagctgatcgacgggaagccgttcgcgatcacgccggagcacgtcaac
ttcgggctcgcgatcgacatgaagggcaaggacggctcccgcacgctcgtcgtggcctcg
atcaagggctgcgaggacatgtcgttcctgcagttctggcaggcctacgaggacatcgtc
aagaaggcccgcaacaacaagctcaccgccgacgacttctccggcaccacgatctcgctg
accaacccgggcggcatcggcaccaaccactcggtgccgcgcctgcaggccggccaaggc
gccatcatcggcgtcggcgccatgcagtacccggccgccttcgagggcaccagcgagaag
acgctggtcgacctcggcatcagcaagatcatgacgctgacctcgacctacgaccaccgc
atcatccagggcgcggagtcgggcgagttcctcaagcgcatccaccagctgctgctcggc
gaggacggcttctacgacgacgtcttcaccagcctgcgcctgccgtacgagccgatccgc
tgggtcgccgacatcccggacggcccggtcgacaagaccgcccgcgtgatcgagctgatc
gacgcgttccggatgcgcggccacctgatggccgacaccgacccgctgaactaccgccag
cgcagccacgcggacctggacgtgctgtcccacggtctcacgctctgggacctcgaccgc
gagttcccggtcggcggcttcgccggccaggagcggatgaagctgcgcgacatcctcggc
gtgctgcgcaactcgtactgccgcacggtcggcatcgagtacacccacatcctcgacccc
gaggagcgccgctggatccaggagcgcgtcgagatcccgcacgagaagccggaccccgcg
gtccagaagtacgtgctctcgaagctgaacgccgccgaggcgttcgagacgttcctgcag
accaagtacgtcggccagaagcggttctcgctcgagggcggcgagacggcgatcccgctg
ctcgataccatcctcgacaaggccgccgagcacgagctcgacgaggtcgtcatcggcatg
ccgcaccgcgggcggctgaacgtgctggcgaacatcgtcggcaagccgatcagccagatc
ttccaggagttcgagggcaacctcgacccgggccaggcgcacggctccggtgacgtgaag
taccacctcggcgccgagggcaagtacttccggatgttcggcgacggcgagaccaaggtg
tcgctgacggcgaacccgtcccacctggagacggtcgacccggtgctcgagggcatcgtc
cgcgccaagcaggacatcctggacaagggcggcgagggctacaccgtgctgccggtcctg
atgcacggcgacgcggccttcgcgggccagggcgtcgtcgccgagacgctgaacctgtcg
ctgctgcgcgggtaccgcaccggcggcaccgtgcacgtcatcgtcaacaaccaggtcggc
ttcacgaccgcgccggagcactcgcgctcgtcgcagtacgccaccgacgtcgcgaagatg
atcggctcgccgatcttccacgtgaacggcgacgaccccgaagccgcgcactgggtggcc
aagctcgccgtcgagtaccgccaggcgttccacaaggacgtcgtcatcgacctgatctgc
taccgccgccgcggccacaacgagggcgacgacccctcgatgacgcagccggcgatgtac
gacatcatcgacaccaagcgttcggtgcggaagacctacaccgagtcgctgatcggccgc
ggcgacatctccgtcgaggaggccgaggccgcgttgcgcgacttctcgagccagctggag
cacgtcttcaacgaggtgcgtgagctggaaaagcacccggcgaaggccagcccctccgtc
gaggaggagcagcaggtgccggccaaggtggcgacggcgatcaccggcaagacgctggag
cacatcggcgacgcgttcgtgaacgtgccggacggcttcaccccgcacccgcgcgtcaag
ccggtcatggagcgccgccacaagatgtcccgcgagggcgacatcgactgggcgttcggc
gagctgctggcgttcgggtcgctggcgatggaaggccggctggtccggctgtccggccag
gactcgcgccgcggcacgttcacccagcggcactcggtgttcatcgaccgcaagaccggc
caggagtactcgccgctgcagaacctggccgacggccagggccgcgtgatgatctacgac
tcggcgctgtcggagtacgcggccgtcggcttcgagtacggctactcggtggccaacccc
gagtcgctggtcatgtgggaagcgcagttcggcgacttcgtcaacggcgcccagacggtg
atcgacgagtacatctcctccggcgaggccaagtggggccagcgttcggacgtcgtgctg
ctgctgccgcacggccacgagggccagggcccggaccacacgtccggccgcatcgagcgc
ttcctctcgctgtgcgcggagggctcgatgacggtggcggtcccgtcaaccccggcgaac
tacttccacctgctgcgccgccacgccctcgacggcatccagcgcccgctggtcgtcttc
acgccgaagtcgatgctgcgcaacaaggccgcgacctcgccgaccgaggacttcaccggc
gaaagccggttcatgtccgtcatcgacgacgtcaccccggacccggcgaagatccgcaag
gtgctgctgacctccgggaagctgtactgggagctggtggcggagcggacgaagcgcgag
gccgacgacgtcgcgatcgtgcggatcgagcagtactacccgctgccgaagaagaagctg
ctggcggcgctggagcgctacacgaacgcgacgcaggtcgcgtgggtccaggaggagccg
gaaaaccagggtgcgtggccgttcttcggcctgaacctgccccggaagttcccggaggtg
ctctcgggcctgcaggtcgtgtcgcgccgcccgatggcggccccgtcggccggctcgtcg
aaggtgcacgaggtcgagcagaaggcgctgatcgcgaaggcgttcgactga

DBGET integrated database retrieval system