KEGG   Nostoc sp. PCC 7120: all4008Help
Entry
all4008           CDS       T00069                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    all4008
   01230 Biosynthesis of amino acids
    all4008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all4008
   00620 Pyruvate metabolism
    all4008
  Nucleotide metabolism
   00230 Purine metabolism
    all4008
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     all4008
Exosome [BR:ana04147]
 Exosomal proteins
  Proteins found in most exosomes
   all4008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(4827144..4828913)
Genome map
AA seq 589 aa AA seqDB search
MQLRDSVRRTKIVATIGPATSSPEMLKAIIEAGATTLRLNFSHGSHADHQRSIRLIRQTA
FELNQPVAILQDLQGPKIRLGKFENGSIVLAKGDRFTLTNRPVVGSQEISCVTYDYLADE
VPVGAKILLDDGRVEMVVEDINRDKGDLNCRVTVAGKLSNNKGVNFPGVYLSIKAMTDKD
REDLMFGLDQGVDWVALSFVRNPQDIIEIKELISSTGKQVPVVAKIEKHEAIEQMEAVLA
LCDGVMVARGDLGVELPAEDVPVLQKRLIATANRLGIPIITATQMLDSMVSNPRPTRAEV
SDVANAILDGTDAVMLSNETAVGSYPVEAVATMARIAERIEQEEAMASKLRQMRDNRRSI
PNAISQAVGQIAEQLGAAAIMTLTQTGATARNVSKFRPQTPILAVTPHVNVARQLQMVWG
VKPLLVLELPSTGQTFQAAINVAQEHSLLFEGDLVVMTAGTLQGVSGSTDLIKVEVVTAV
LGQGIGLGQGLVSGCARVAHTGMDVGNFNAGDILVAPRTGADFVEAIRKAGGIITEDESL
TSHAAVIGLRLGVPVIVGVKKATQVIRDGAILTLDLQRGLVYSGAVGTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaagagattctgtacgccggacaaaaatcgtcgctacaattggccctgccact
agtagccccgaaatgctgaaagccatcattgaagcgggtgcaacaacgctgcgactcaac
ttttcccacggttcccacgccgaccatcagcgtagtattcgcctaattcggcaaaccgct
tttgaactaaatcagccagtggcaattctccaagatttgcaagggccaaaaattcgcttg
ggaaagtttgaaaacgggtctatagttttagctaaaggcgatcgcttcaccttaacaaat
cgcccagttgttggtagtcaagaaattagctgtgtcacctacgattatttggcagatgag
gtccctgtaggtgcaaaaatcctcctggatgatggccgtgtagaaatggtggtagaggat
atcaaccgcgacaaaggggatttgaactgtcgggtgactgtagcaggtaagttatctaat
aacaaaggtgttaactttcctggcgtttatctctcaattaaagccatgaccgacaaagat
cgtgaggatctgatgtttggtctagatcagggtgttgattgggtagccctttcctttgtc
cgcaatccgcaagacatcattgaaattaaagagctaatttccagcactggtaaacaagtg
ccggtagttgccaaaatagaaaagcatgaagcgatcgaacaaatggaagcagttctcgct
ttatgtgatggcgtaatggtggctagaggcgatttaggtgtagaactaccagcagaagat
gtccccgtactacaaaagcgcttaattgccacagcaaaccgcttggggattcccatcatc
actgctactcaaatgttagatagcatggtgagcaatccccgtcccacccgcgcggaagtg
tccgatgtagccaatgccattcttgatggtacagatgcggtcatgctctccaatgaaacg
gctgtgggtagctacccagtggaagcagtggcgacaatggcaagaattgccgaacgcatc
gagcaggaagaagctatggctagtaaattacgccaaatgcgagataaccgccgttctatt
cccaacgccatcagccaagctgtaggtcaaattgctgaacagttgggagcagcagcaatt
atgactctcacccaaacaggggcgactgcacgcaacgtttccaaattccgcccccaaaca
ccaatcttggcagtaacaccccacgttaacgtagctcgtcaactacaaatggtgtggggc
gtaaaacctttgttggtcttagaattaccttccactggtcaaactttccaagccgccatt
aacgtcgcccaagagcatagtttactgtttgaaggtgatttagtcgtgatgacagccggg
acgttacaaggggtatctggctcaacggacttgattaaagttgaagtggtaacggcagtt
ctaggacagggaattggtctaggacagggtttggtaagcggttgtgctagggttgctcac
accgggatggatgtggggaactttaacgctggtgatattttggttgcaccccgcacaggt
gcagattttgtcgaggcgattcgcaaagccggcgggattattacagaggatgaaagttta
actagtcatgcggcggtgattggtttacgcctgggtgtgccggtgattgtaggtgtgaag
aaagccacgcaagttatccgtgatggagcaattttgactctggatttgcaacgaggttta
gtttattccggagcagtaggaactccttaa

DBGET integrated database retrieval system