KEGG   Nostoc sp. PCC 7120: alr0609Help
Entry
alr0609           CDS       T00069                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
ana  Nostoc sp. PCC 7120
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    alr0609 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    alr0609 (nrtB)
Transporters [BR:ana02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    alr0609 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
707802..708641
Genome map
AA seq 279 aa AA seqDB search
MTAVLGNRARVRKSQKAINNFLWKKVVPPLVALGIFLVIWQLLCLNPNFKLPGPIETFSE
TWDPFIINPFFDNGESDKGLGWQILSSLGRVGLGFSLAAIAGIILGILIGVNPLVYNAVD
PIFQVLRTVPPLAWLPISLAAFQQANPSAIFVIFITSIWPILLNTTVGVQQIPQDYINVA
KVLRLKGVKYFFKIVFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGSFIWDAYNT
TTETNLSEIILALIYVGLVGLLLDRLVGFVASKVVADQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgttttagggaatcgcgctagggtaaggaaatctcaaaaagctatcaataat
ttcttgtggaaaaaagttgtaccacccttagtagcattgggaattttcctggttatttgg
caactactttgtttgaatcctaactttaaattgccggggccgatagaaaccttttcggaa
acttgggacccttttattatcaatccattttttgataacggtgaaagtgataagggctta
ggctggcaaatattgagtagtttgggacgggttggtttaggtttttctctagcggcgatc
gccggaattatactaggcattttaattggtgtaaatccattagtttataatgcggtagat
cctatatttcaagtcttgcgaacagtcccacctctggcatggctaccgatttcattggca
gcatttcagcaagctaatccctcagcaattttcgttattttcattacctcaatttggccg
attctcctgaatactacggtaggtgtacaacaaattccccaggactacattaatgtagct
aaggtgttacggctgaagggggtaaagtacttttttaaaattgtctttcctgccactgtt
ccctatatctttacagggttaagaattggtattggtttatcttggttagcaattgtggcg
gcggaaatgttggttggtggtgtggggattggttcatttatttgggatgcttacaacaca
actactgaaactaatttgagtgagattattttggcgcttatttatgttggtttggtgggt
ttgttgttagatagattggttgggtttgttgctagtaaagttgtggcggatcagaagtag

DBGET integrated database retrieval system