KEGG   Altererythrobacter namhicola: A6F65_02450Help
Entry
A6F65_02450       CDS       T04447                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
anh  Altererythrobacter namhicola
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:anh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6F65_02450 (ppc)
  Energy metabolism
   00680 Methane metabolism
    A6F65_02450 (ppc)
Enzymes [BR:anh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A6F65_02450 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2472050..2474824
Genome map
AA seq 924 aa AA seqDB search
MTSVDDLIARLQELHRQTKSTPLFNPVFQLSLDLSRKLESGEMSLDSLTALVDELECESL
RSRAQQLDALLGPVALEANDNALGASLAADDFAAFRKRWENPLLHAVFTAHPTFLLEPEQ
HAQVAAAASHGSDLTCHAGGAERPAITLQFEHERAMRAIANAQDARDRIVGNVLRRAKDA
FPAEWDGLEPEPVRFATWVGYDMDGRTDIKWFTSIGFRLAEKAQRLARYTAQLEGVDDSH
DLVPELRAATAYAQERAKDFQSDLTDPAALTVAANRLTAADPRRLLTLKDTIARLEADAR
DSDDTDRAIGLKTLAAAMRSDGLGMGWIHFRVNAKQLHNAIRRRVDPSGEIDLASKGAMS
HLRRAIEDIEPLRSNFAALAIESSTAIRQFLAMAQILAHVDSDTPIRMLVAECEEPATML
SALYFAKLFGIEDKVDISPLFETETALEHGGRFVDELLAEDAYQAYAKARGRVAIQTGFS
DAGRFVGQVPASLAIERLQGRLAEAMQENGLGDCAALIFNTHGESMGRGAHPAGMEDRLT
WPLSPWAKRRFMRSGIRLEPEVSFQGGDGYLKFATPELAFATLTRIAELRPAEADPDAPT
DPFYRRTDLSLDFYRAVKEHQRDHLESRTYSRAITAFGLGLLNSTGSRVSRRQSDLSADR
EMSLRQIRAIPHNAILQQLGYPVNIIAGIGSAAEGNYEELGALLQESARGRQIIRLVRAS
NALASIKTVAAYGELFNSAYWASRTYRGTENNISEACEALADYLVKDDRNGVFRRLASRL
RSDALKLHRLLDVIPDEAPRDDREHVRRVIGAAQAVRLALLQHMFIKAVSIPAFSRANDI
SRDDVIEMVFTLRIDDALAQLRRAFPVHFPRIGDFDLDEPTDYPESGDAGYAALRAEFID
PIERAYGLTLRISTAIANEFGAHG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtcgatgacctgatcgcccgcctgcaggaattgcaccggcagaccaagtcc
acgcccctgttcaacccggtcttccagctgtcgctcgacctgtcgcgcaagctggaaagc
ggcgagatgtcgctcgatagcctgaccgcgctggtggacgagctggagtgcgaaagcctg
cgcagccgcgcgcagcagctcgacgcactcctcggccccgtggcgctggaagcgaacgac
aacgctctgggggcaagccttgcggccgatgacttcgcggcattccggaagcgctgggaa
aacccgctgctgcatgccgtcttcaccgcgcacccgaccttcctgctcgagcccgaacag
cacgcgcaggttgcggcggctgccagccacggcagcgacctgacctgccatgccggcggc
gcagagcggccggcaatcacgttgcagttcgaacacgaacgcgccatgcgcgccatcgcc
aatgcgcaggacgcgcgcgaccggatcgtgggcaatgtgctgcgccgcgccaaggacgcc
ttccccgccgaatgggacgggctggagcccgaaccggtccgcttcgccacctgggtcggt
tacgacatggacgggcgaaccgatatcaagtggttcacctccatcggcttccgcctggcg
gaaaaggcacagcggctggcgcgctatacggcgcagctggaaggtgtcgacgacagccac
gacctggtgccggaactgcgtgcggcaaccgcctatgcgcaggaacgggcgaaggatttc
cagtccgacctgaccgatcccgccgcgctgacggttgcggccaaccgcctcaccgcagcc
gatccgcggcgcctgctgacgctgaaggacacgatcgcccggctggaagccgacgcgcgt
gacagcgatgacacggaccgcgccatcgggctgaagacgctcgccgccgcgatgcgcagc
gatggcctgggcatgggctggatccacttccgcgttaatgccaagcagctgcacaatgcc
attcgccgccgcgtggacccttcgggcgaaatcgacctggccagcaagggcgccatgtct
cacctgcgccgcgcaatcgaggatatcgagccgctgcgttccaacttcgccgccctcgcc
atcgaaagcagcacggcgatccggcaattcctggccatggcgcagatccttgcccatgtg
gattcagacacgcccatccgcatgctggtggcggaatgcgaagagcctgcaaccatgctc
tccgcgctctatttcgcgaagctgttcgggatcgaggacaaggtcgatatctcgcccttg
ttcgaaaccgaaaccgcgctggaacatggcgggcgcttcgtggacgagctgctggccgag
gacgcttaccaggcatacgccaaggcgcgcgggcgcgtggcgatccagaccggtttctcc
gatgcagggcgtttcgtggggcaggttcccgccagcctcgccatcgagcggctgcagggc
cggctggccgaagcgatgcaggaaaacggcctgggcgactgcgccgcgctgatcttcaac
acccatggcgaaagcatgggccgcggcgcgcatcccgccggcatggaagaccggctcaca
tggccgctctccccatgggccaagcggcgtttcatgcgcagcggcatccggctggagccc
gaggtcagcttccagggcggcgacggttacctgaaattcgccacgcccgaattggcgttc
gccaccctcacccgcatcgccgaactgcgcccggccgaagcggatccggacgcgccgacc
gacccgttctatcgccgcacggacctgagcctggatttctaccgcgcggtaaaagaacac
cagcgcgaccacttggaaagccggacttacagccgcgccatcaccgccttcggccttggc
ctcctcaattccaccggcagccgcgtcagccgccgccagagcgatctcagcgccgaccgc
gagatgagcttgcgccagatccgcgccatcccgcacaatgccatcctgcagcagctgggt
tacccggtgaatatcatcgccggtatcggcagcgcggcggaaggcaattacgaggagctg
ggcgcgctgctgcaggagagcgcgcgcggccgacagatcatccgcctggtgcgcgcgtcc
aatgcgctcgccagcatcaagacggtcgcggcttacggcgagcttttcaattccgcctac
tgggccagccgcacctatcgcggaacggaaaacaacatttccgaagcctgcgaggcgctg
gccgattacctggtgaaagatgatcgcaacggagtgtttcgccgcctcgccagccgcctg
cgcagcgacgcgctgaagcttcaccgcctgctggatgtgatccccgacgaggccccacgc
gacgaccgcgagcatgtgcgccgcgtgatcggggcagcgcaggctgttcgcctcgccctg
ctgcaacacatgttcatcaaggccgtcagcatcccggccttcagccgcgcgaacgatatc
agccgcgacgacgtgatcgagatggttttcaccctccgcatcgacgatgcattggcgcag
cttcggcgcgccttcccggtgcatttcccgcgcatcggcgacttcgacctggacgagccg
accgactatccggaaagcggggatgccggttatgcagcacttcgcgccgagttcatcgat
ccgatcgagcgcgcctatggcctgaccctgcgcatctcgaccgcgattgcgaatgaattc
ggggcgcatggttag

DBGET integrated database retrieval system