KEGG   Aspergillus nidulans: AN5577.2Help
Entry
AN5577.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ani00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AN5577.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AN5577.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
V
AA seq 223 aa AA seqDB search
MASLIRTSLRTGLRASSSSAAPLTFTRGKATLPDLAYDYGALEPAISGKIMELHHKNHHQ
TYVNSYNTAIEQLQEAQASNNIAAQIALKPLINFHGGGHINHTLFWENLAPKNAGGGEPP
SGALSKAINESFGSLENFQGQMNTALAAIQGSGWAWLVQDKQTGSIAIKTYANQDPVVGQ
FKPLLGIDAWEHAYYLQYQNRKAEYFKAIWEVINWKAVEKRFA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcttatccgcacttccctccgcactggcctgcgcgccagctcttcctcggct
gcgcccttgacctttacccgcggcaaggctacgctgcccgatcttgcttacgactatggc
gctttggagcccgctatctccggcaagatcatggagctgcaccacaagaaccaccaccag
acctacgtcaacagctacaacaccgccatcgagcagctccaggaagcccaggcaagcaac
aacattgccgctcagattgccctcaagcctctgatcaacttccacggcggtggtcacatc
aaccacaccctcttttgggagaacttggctcccaagaacgccggcggtggtgagcctcct
tctggtgctctctccaaagccatcaacgagagcttcggtagcctcgagaatttccagggc
cagatgaacactgctctcgccgctatccagggaagcggctgggcctggctggttcaggac
aagcaaactggcagcatcgccatcaagacctacgcgaaccaggaccccgttgttggacag
ttcaagcccctccttggtattgatgcttgggagcacgcctactacctgcaataccagaac
cgcaaggccgaatacttcaaggcgatctgggaggtcatcaactggaaggccgttgagaag
cgctttgcgtaa

DBGET integrated database retrieval system