KEGG   Anaeromyxobacter sp. K: AnaeK_0417Help
Entry
AnaeK_0417        CDS       T00748                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
ank  Anaeromyxobacter sp. K
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
474314..476074
Genome map
AA seq 586 aa AA seqDB search
MRLRGPPQPPPRHATLAHALAAAAAHPSGATFLDLHERETFLPWSEVRARAERAAANLVH
LGIRRGDRVAIVLRTEPAFLDAFFGAWLAGAVPVPLYPPVRLGRLDAYAVDTGRMIQVAG
ARLVVSAGGTRRLLGGAVERGGPELGCVDVSALSALPARIAREPEPDALGLVQFSSGTTV
DPKPVALTHRALAAMTDALVAATSAGPDDVLVSWLPLYHDMGLIGCLLAAMSYPGPLVLI
PPEHFLTRPALWLRALARRRGTISAAPSFAYAYAADRVQDADLAGLSLATVRLLLDGAEP
VSAVALRRFAERFRPHGLDPRALVPVYGLSEAALAVTFARPGGPLGGLGVDAARLASDGV
VAPGGREVMPVGTPVPGVEVELRGEAGVRVGEGRVGRVFVRGPALMREYLGDPEATARAL
RGGWLDTGDLGFVVDGALHLHGRARDLVIVRGANHAPEEFEAPLAALPGLRPGCAVALGF
EPEGGAGEALLVLAERARDEGTPDAELEARVRRAVLAATGIAPHTVRLLAPGTLPRTSSG
KLRRAEALRRFQAGTLTPPQPVSALRLALAAARSQLAFGRSRRRGG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctgcgcgggccgccccagccgccgccgcgccacgccacgctggcgcacgcgctg
gcggccgcggccgcgcacccctccggcgcgaccttcctcgacctgcacgagcgcgagacg
ttcctgccgtggtcggaggtccgcgcccgggccgagcgcgccgccgccaacctcgtccac
ctcggcatccggcgcggcgatcgggtcgccatcgtgctccggaccgagccggccttcctg
gacgcgttcttcggcgcgtggctggccggcgcggtgccggtgccgctctacccgccggtg
cggctgggccggctcgacgcgtacgcggtggacaccggccggatgatccaggtggcgggg
gcgcgcctggtcgtctccgcgggcggcacgcggcggctgctcggcggcgccgtcgagcgg
ggcgggccggagctcgggtgcgtggacgtgtcggcgctctcggcgctgcccgcccgcatc
gcgcgcgagccggagccggacgcgctcggcctggtgcagttctcctccgggacgacggtg
gacccgaagccggtcgcgctcacccaccgcgcgctcgcggccatgaccgacgcgctggtc
gcggcgacctcggcgggcccggacgacgtgctcgtgtcgtggctgccgctctaccacgac
atggggctcatcggctgcctgctcgccgcgatgagctacccggggccgctcgtgctcatc
ccgcccgagcacttcctcacccgcccggcgctctggctgcgcgcgctggcccggcggcgc
ggcacgatctcggccgcgcccagcttcgcgtacgcgtacgcggccgaccgggtgcaggac
gccgacctcgccggcctctcgctcgccacggtgcggctgctgctcgacggcgccgagccg
gtctcggcggtggcgctgcggcgcttcgccgagcgcttccggccccacgggctcgacccg
cgggcgctcgtgccggtgtacggcctcagcgaggcggcgctggcggtgacgttcgcgcgc
cccggcgggccgctcggcgggctcggggtggacgccgcccggctcgcgtcggacggcgtg
gtcgcgcccggcgggcgggaggtgatgcccgtcgggaccccggtcccgggcgtcgaggtc
gagctgcgcggcgaggccggcgtgcgcgtgggggaggggcgcgtcgggcgcgtgttcgtg
cggggccccgcgctcatgcgcgagtacctgggcgacccggaggcgaccgcgcgggcgctc
cggggtggatggctcgacaccggcgacctcggcttcgtggtggacggcgcgctccacctc
cacggccgcgcccgcgacctcgtgatcgtgcgcggcgcaaaccacgcgccggaggagttc
gaggcgccgctcgcggcgctgcccggcctgcgcccgggctgcgcggtggcgctcggcttc
gagccggagggcggcgccggcgaggcgctgctcgtgctcgcggagcgcgcccgggacgag
gggaccccggacgccgagctcgaggcgcgggtccggcgcgcggtgctggccgcgaccggc
atcgcgccgcacaccgtgcggctgctcgcgcccggcacgctcccgcggacgtcctccggc
aagctgcggcgcgccgaggcgctgcgccgcttccaggcggggacgctcacgccgccgcag
ccggtgagcgcgctccgcctcgccctcgccgccgcgcgctcgcagctcgccttcgggcgg
tcgcggcgccgcgggggctga

DBGET integrated database retrieval system