KEGG   Anoxybacillus sp. B2M1: GFC28_2805Help
Entry
GFC28_2805        CDS       T04370                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:anm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFC28_2805 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    GFC28_2805 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    GFC28_2805 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GFC28_2805 (adh)
   00626 Naphthalene degradation
    GFC28_2805 (adh)
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GFC28_2805 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2789498..2790511)
Genome map
AA seq 337 aa AA seqDB search
MKAAVVHQFKQKLQIEEVEKPKLEYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGVVVEVAPGVKSIKVGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGGY
AEYCKAPADYVARIPDNLDPVEVAPILCAGVTTYKALKVSNAKPGDWVAIYGIGGLGHIA
LQYAKAMGFNVVAVDISDDKAELATKLGADIAINGLKEDPVQAIHEKVGGVQAAISVAVT
KKAFEQAYQSIKRGGCLVVVGLPHDELPIPIFDTVLNGITVKGSIVGTRKDMQEALNFAA
QGKVRPIVEAVSLEHINEVFERMEKGQINGRIVLTMQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttgttcatcagttcaaacaaaagcttcaaattgaagaggtagaaaaa
ccaaagcttgagtacggcgaagtgctcgtgaaaatcgaagcgtgcggcgtttgccatacc
gatttgcatgccgctcatggggactggcccgtcaaaccaaagcttccgctcattccagga
catgaaggagtgggagtcgtcgtcgaagtggcaccgggggtgaaatcgattaaagtggga
gatcgcgtaggaattccttggctttactccgcatgcggggaatgtgaatattgcttaagc
ggccaagaaaccctttgccctcatcaattgaatggcggttattctgttgacggcggatac
gcggaatattgtaaagcgccagcggattatgtcgcgcgcattccagataacctagatccg
gtggaggtcgcaccgattctttgcgccggggtcacaacctataaagctctgaaagtatcc
aatgctaaaccgggggattgggtagccatttatggaatcggcggcttaggacatatcgct
ctgcaatacgcgaaagcaatgggattcaatgtagtggccgtcgatatcagcgatgataaa
gcagaattggctacaaaattaggagcggatatcgccattaatggcttaaaggaagatccg
gtacaagccattcatgaaaaagtcggcggcgtacaagcggctattagcgtagctgtcacg
aaaaaagcatttgaacaagcctatcaatctatcaaacgcggcggttgtctcgttgtcgtc
ggattgcctcatgacgagctgccgatccctattttcgataccgtcttaaacggcatcacc
gttaagggatccatcgtaggaacaagaaaggacatgcaggaagcgcttaacttcgcagcc
caaggaaaggttcgccctattgtggaagcggtttctttggagcatattaacgaagtgttt
gaacggatggaaaaaggacaaatcaacggccgcatcgttttaaccatgcaataa

DBGET integrated database retrieval system