KEGG   Aneurinibacillus sp. XH2: ACH33_08320Help
Entry
ACH33_08320       CDS       T04247                                 

Definition
(GenBank) hypothetical protein
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
anx  Aneurinibacillus sp. XH2
Brite
Enzymes [BR:anx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     ACH33_08320
Peptidases [BR:anx01002]
 Metallo Peptidases
  Family M4: thermolysin family
   ACH33_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP
Motif
Other DBs
NCBI-ProteinID: AMA72857
UniProt: A0A0X8D2S5
LinkDB All DBs
Position
complement(1673696..1675450)
Genome map
AA seq 584 aa AA seqDB search
MKKKVVLLGLSMGLLSNPAIGTVWAEGAANPVFFQNENEESTTFTSTTSDQLQINKMKAS
PFDVMAYAKRWKRKVHRNPESNKVEFISGQFKPKNPYNFNTVVQEFVGANSDVFKVTTED
TIQVMKEEMTPLGDYVIRTQQFFRGVPVYGSTQVLNLNQKGVVTAWSGGIVSELNKQENL
NKAKNLSQQAAIQKAEHDLGFIPEYYIPPAVELVIYMKEEIAHYAYHVNLNFLNPQPGNW
DYFIDANDGTILNKVNRIHQVQVARNMVDSNQIGFGIGVHGDKKQVNTVFSNSYYYLQDN
TRGKGIYTYDAKNSNRLPGTLWRNADNQFTAKYDGPAVDAHYYAGVVYDYYKNKFNRNSY
DGAGAPIKSTVHYGKSYTNAFWNSYQMVYGDGDGSTYPFSGALDVVGHELTHAVTEKTAN
LIYENESGALNEAMSDIFGTLIEYYNNQNPDWEMGEDLSFNRQGFRSLADPTKYGDPDHY
SKRYRGSNQNYLVHTNSGIINKAAYLISEGGTHYGVTVNGIGKEKLGNIFYRALTQYLTE
SATFSQMRAAALQAATDLYGAASAEVISVGKAFDAVGVNSIDLS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaaagttgtattattggggctgtctatgggtctattaagtaatcctgctatt
ggaacggtatgggcagaaggagctgcgaatcctgtattttttcagaatgagaatgaagaa
tcgaccacgtttacttcaactacctcggatcaattgcaaataaataaaatgaaggcatcc
ccttttgatgtgatggcatatgcaaagagatggaaaagaaaggtacaccgtaatcctgag
agcaacaaagtagaattcatttcagggcaatttaaacctaaaaatccttataatttcaac
actgttgttcaggaattcgtaggtgcaaactcggatgtttttaaagtaacaacggaagac
accatacaggtaatgaaagaagaaatgactcctttgggagattatgtaattcgtacccag
cagttcttcagaggagtgcccgtatatggttcgacacaagtattaaacttaaatcaaaaa
ggagtggtaacagcatggtccggagggattgtttcagaactgaacaagcaagaaaaccta
aataaagcaaagaatcttagtcaacaggcagcgattcaaaaagccgaacatgacctaggt
tttatccctgagtattatattccaccggctgtcgaacttgtaatttacatgaaagaagag
attgcgcattacgcttaccatgtaaatctaaattttctgaatccacaaccgggaaattgg
gattactttatagatgcaaatgatggaacaattttaaataaagtcaatcgtatccatcaa
gtgcaagtggcgcgaaatatggtcgattctaaccaaattggatttggaataggagtgcat
ggagataaaaaacaagtaaatacagtattttctaattcgtattactatttgcaagataat
actagaggtaagggcatttatacatacgatgccaaaaattcaaaccggctcccgggcacg
ctatggagaaacgcggataatcagtttactgcaaagtatgatggtcccgctgtagacgca
cattattacgcaggagttgtatacgattactacaaaaataagtttaatcgtaacagctat
gatggagcaggagcgccaataaaatcaactgttcattatgggaaatcgtatacgaacgcg
ttttggaattcctatcaaatggtttatggagatggggacgggtctacctatccattctca
ggagcattggatgtagtaggacatgagttgacgcatgctgtaacggaaaaaacggcaaat
ttaatttacgaaaatgagtctggtgctttaaatgaagcaatgtccgatatttttgggaca
ttaattgagtactacaataatcagaatcctgattgggaaatgggtgaggacttaagtttt
aatagacagggatttcgttcattagctgatccgacaaaatatggtgatccggaccattat
tccaaaagataccgtggttcaaaccaaaactatttagttcatacaaacagcggaattata
aacaaggctgcttatcttatcagtgaaggcggaacccactatggcgttaccgtgaatgga
atcggcaaagagaaactgggaaatattttttacagggcattaacacagtatcttacagag
tcagctacatttagccaaatgagggcagcagctttacaagccgcgacggatttatatgga
gcagcaagtgctgaagttataagcgtgggcaaagcttttgatgcagtaggagtcaattct
atagacttgtcctaa

DBGET integrated database retrieval system