KEGG   Azoarcus olearius: dqs_1093Help
Entry
dqs_1093          CDS       T04423                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aoa  Azoarcus olearius
Pathway
aoa00620  Pyruvate metabolism
aoa00680  Methane metabolism
aoa00710  Carbon fixation in photosynthetic organisms
aoa01100  Metabolic pathways
aoa01120  Microbial metabolism in diverse environments
aoa01200  Carbon metabolism
Module
aoa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aoa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    dqs_1093
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    dqs_1093
   00680 Methane metabolism
    dqs_1093
Enzymes [BR:aoa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     dqs_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: ANQ84157
LinkDB All DBs
Position
complement(1146489..1149242)
Genome map
AA seq 917 aa AA seqDB search
MTPDKDAPLREDIRLLGRLLGDTVRDQQGAASFDLIERIRQTSVRFRRDEDLAARRELED
TLDALSREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLLAGSAPREGSLAHAVGHALD
EQRLDPTDLAAFFDTALISPVLTAHPTEVQRKSILNCQTVIARLLDERDRMQLTPDEAEA
NLDALRRAVLTLWQTRMLRPAKLSVIDEVNNGLSYFETTFLRELPRLYAALEDRLAGAQP
ALANHELPAFLQVGSWIGGDRDGNPYVTADVLEEALAMQARVALDYYLDELHTLGSQLSL
SQGLVGASDALLALADRSPDQSPHRSDEPYRRAIAGIYARLSATYRNLLGHPPARHAVAE
AEPYADVAALADDLDTLHRSLVANGTAALARGRLRHLRRAVRVFGFHLAPIDLRQNSDVH
ERVVAELLEVARPGAAYLAQDEAGRCALLLDELATARPLASPHVRYSDDSEGELAIFRAA
RRAHLRYGRGAIHNCIISKTDDLSDLLELAVLLKEAGLLRPLEKALDVNIVPLFETIGDL
ENAAGVMDRLFSIPVYRELLAARDQTQEVMLGYSDSNKDGGFLTSGWALYKAEGELVEVF
GRHGVRLRLFHGRGGSVGRGGGPSYQAILAQPDGAVQGQIRLTEQGEVIAAKYGNPEVGR
RNLEVLVAATLETSLRRDGGDATPRTFLDTMQALSDAAFTCYRGLVYETPGFEQYFWEST
VISEIAGLNIGSRPASRKKGTRIDDLRAIPWVFSWSQCRLMLPGWFGFGSAVKQWLAAHP
KDGLGLLQRMYREWSFFATLLSNMDMVLSKTDLAIASRYAELVKDPVLRDSIFERIRSEW
KDTVDALLAITEQVELLDANPLLKRSIRNRFPYLDPLNHVQVELLRRHREGNGEDARIRN
GIHISINGIAAGLRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgactccagacaaggacgcacccctgcgcgaagacatccgcctgctcggccgcctgctc
ggcgataccgtgcgcgaccagcagggcgccgccagcttcgacctgatcgagcgcatccgc
cagacctcggtgcgctttcgccgcgacgaagacctcgccgcccggcgcgaactcgaggac
accctggacgcgctgtcgcgcgagcagacgatccaggtggtgcgcgcgttcagctacttc
tcgcacctcgccaacatcgccgaggaccagcaccacatccgccgctcgcgcgcgcacctg
ctggccggctccgccccgcgtgagggcagcctggcccatgccgtcgggcatgcgctcgac
gaacagcggctcgaccccaccgaccttgccgcgttcttcgacaccgcgctgatctcgccg
gtgctgaccgcgcaccccaccgaggtgcagcgcaagagcatcctcaactgccagaccgtg
atcgcccgtctgctcgacgagcgcgaccgcatgcagctcaccccggacgaagccgaagcc
aacctggatgcgctgcgccgggcggtgctgacgctgtggcagacgcgcatgctgcgtccg
gccaagctgtcggtgatcgacgaggtgaataacggcttgtcctacttcgagacgaccttc
ctgcgcgagctgccgaggctgtacgccgcactggaagaccgcctcgccggcgcccagccg
gcgctggccaaccacgagctgcccgccttcctgcaggtgggcagctggatcggcggcgac
cgcgacggcaacccctacgtcaccgccgacgtgctcgaagaggcgctggcgatgcaggcg
cgcgtcgcgctcgactactacctcgacgagctgcacacgctcggctcgcaactgtcgctt
tcacagggcctggtgggcgcctccgacgcgctgctggcgctggccgaccgctcgcccgac
caatcgccccaccgcagcgatgaaccctaccggcgcgcgatcgcgggcatctatgcacgc
ctctccgccacctaccgcaacctgctcggccatccgccggcacgccacgcggtggccgaa
gccgagccctacgctgatgtcgccgcgctcgccgacgacctcgatacgctccaccgctcg
ctggtcgccaacggcaccgcggcgctcgcacgcgggcgcctgcgccacctgcgccgcgcg
gtacgggtgttcggctttcacctcgcgccgatcgacctgcgccagaactccgacgtgcat
gagcgcgtcgtcgccgagctgctggaagtcgcgcgccccggcgccgcctatctcgcccag
gacgaggccggccgctgcgccctgctgctggacgaactggcgacggcgcggccgctcgcc
tcgccgcacgtgcgctacagcgacgacagcgagggcgagctggcgatcttccgcgccgcg
cgtcgcgcccacctgcgctacgggcgcggtgcgatccacaactgcatcatctccaagacc
gacgacctgtccgacctgctcgaactcgcggtgctgctgaaggaagccgggctgctgcgc
ccgctggagaaggcgctggatgtgaacatcgtgccgctgttcgagaccatcggcgacctc
gagaacgccgccggcgtcatggaccgcctgttctccatcccggtctatcgcgaactgctc
gccgcacgcgaccagacccaggaggtgatgctcggctattccgacagcaacaaggacggc
ggcttccttacctcgggctgggcgctgtacaaggcagagggtgaactggtcgaggtgttc
ggacgccacggcgtgcgcctgcgcctcttccacggccgcggcggctcggtgggccgcggc
ggcgggccgagctaccaggccatcctcgcccagccggacggcgcggtgcagggccagatc
cggctcacggaacagggcgaggtgatcgcggccaagtacggcaacccggaggtgggccgc
cgcaacctcgaagtactggtcgccgccacgctggaaaccagcctgcgccgcgatggcggc
gacgccacgccacgcaccttcctcgacacgatgcaggcgctgtcggacgccgccttcacc
tgttatcgcgggctggtgtacgaaacgccgggcttcgagcagtacttctgggagtcgacg
gtgatctccgagatcgccggcctgaacatcggttcgcgcccggcttcgcgaaagaaaggc
acccgtatcgacgacctgcgcgcaatcccgtgggtgttctcgtggtcgcagtgccggctg
atgctgccgggctggttcggcttcggcagcgcggtaaagcagtggctggcggcccatccc
aaggacggcctggggctgctgcagcggatgtaccgcgagtggtcgttcttcgcgacgctg
ctgtccaacatggacatggtgctgtccaagaccgacctcgcgatcgcctcacgctacgcg
gaactggtgaaggacccggtgctgcgggacagtatcttcgagcgcatccgcagcgaatgg
aaggacaccgtggatgcgttgctggcgatcaccgagcaggtggaactgctggacgccaac
ccgctgctcaagcgctcgatccgcaaccgctttccctacctggacccgctcaaccacgtc
caggtggagctgctgcggcgccaccgcgaaggcaacggcgaggatgcccgcatccgcaac
ggcatccacatctccatcaacggcatcgccgccggcctgcgcaacagcggctga

DBGET integrated database retrieval system