KEGG   Azoarcus olearius: dqs_2833Help
Entry
dqs_2833          CDS       T04423                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
aoa  Azoarcus olearius
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aoa00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    dqs_2833
Enzymes [BR:aoa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     dqs_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3057104..3058408
Genome map
AA seq 434 aa AA seqDB search
MKTKIVYVGMSADLVHSGHLNIIRHAASLGEVVIGLLTDKAIASYKRIPYMPFEQRMAVV
ENIKGVSRVVPQTTLDYTPNLELLKPDYVVHGDDWREGVQRETRQKVIDTLKQWGGELVE
IPYTAGISSTRLQAAIKEIGTTPDIRRSALRRLLQVKPLIRFLDIHNALSGLIIEHTAVD
TPSGRREFDGMWGSSLTDSTAKGKPDIEAVDVSARVQTLNEVLEVTTKPIIYDGDTGGQP
EHFNFTVRTLERLGISAIVIEDKTGLKRNSLFGNDVPQTQESIENFCNKIRTGKRAQATD
EFMIIARIESLILDKGVDDAIERAQAYLAAGADGIMIHSRKTTPDEIFAFCERYRQLENR
KYLVAVPSTYNTVTEEELQQRGVNIVIYANHLLRSAYPAMVETARCILEHHRSSECDARL
LPINDILALIPGTR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagatcgtgtatgtcggcatgagcgccgacctcgtccactcaggccacctg
aacatcatccgccacgccgcaagcctgggcgaagtcgtgatcggactgctgaccgacaag
gccattgcaagttacaagcgcattccgtacatgcccttcgagcaaaggatggcggtggtc
gagaatatcaagggcgtctcgcgcgtggtgccccagacgacgctcgactacacgccgaat
ctcgaattgctcaaacccgactacgtggtgcacggcgatgactggcgcgaaggcgtccag
cgcgaaacgcggcagaaagtcatcgacacgctcaagcaatggggcggcgaactggtggag
attccttacaccgccggcatttcatccacccgtctgcaggccgcgatcaaggaaatcggc
accacgcccgacatccggcgcagcgccctgcgccgcctgctgcaggtcaagccgctgatc
cgctttctcgatatccataacgccctctcggggctgatcatcgagcacaccgcggtggat
acgcccagcggacgacgcgagttcgacggcatgtggggcagcagcctgaccgactcgacc
gcgaagggaaaaccggacatcgaggcggtcgacgtttccgcccgggtgcagacgctcaac
gaagtcctggaagtcaccaccaagcccatcatctacgacggcgataccggcggtcagccc
gaacatttcaacttcacggtccgcacgctggagcgcctgggcatctcggcgatcgtcatc
gaggacaagaccgggctgaagcgcaattcgctgttcggcaacgacgtgccgcaaacgcag
gagagcatcgagaacttctgcaacaagatccgcaccggcaagcgcgcgcaggcgaccgac
gagttcatgatcatcgcccgcatcgaaagcctcatcctggacaagggcgtcgatgatgcg
atcgaacgtgcgcaagcctatctggccgcgggcgcggacggcatcatgatccacagccgc
aagaccacgcccgacgaaatcttcgcgttctgcgagcgctaccgccagctcgaaaaccgc
aagtacctggtggcggtgccgtccacctacaacaccgtcaccgaagaagaactgcagcaa
cgcggcgtgaacatcgtcatctacgccaaccacctgttgcgcagcgcgtacccggccatg
gtcgagaccgccaggtgcatcctggagcatcaccgctcctccgagtgcgacgcccggctg
cttccgatcaacgatatattggcactcattccaggcacccgatga

DBGET integrated database retrieval system