KEGG   Asparagus officinalis (garden asparagus): 109823801Help
Entry
109823801         CDS       T05243                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2 isoform X1
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 109823801
NCBI-ProteinID: XP_020245769
LinkDB All DBs
Position
9
AA seq 1534 aa AA seqDB search
MSDHHGFHAVVGLPTSNCQLDFDKFTKVEDDNELGRDKLDVVKSLKQDEQLGEKDRDSSL
TQEASGELGERSGVSSQIASEMLVETVSYKNSLDPGTSPDSDVYNPVIDVGIMTSEGNNS
ADQVIGNKDVGIITSEGAASTEQMGQNVLVQGAVSDDGLHPAVSTSSNACITSFSVPSLD
SNLYAKAKNEKMKGQVGEQSCLSDHLSALEKFHEPEILNNTKKPTKPTKPGKSKQKKQDF
SNKKNRSCSRSHKKTNKKGSKCKSVAFKSSLPETAELQRPEEFMKAPNYLDNSVLPGEEA
SNLLPEASLHSSKTEGHKLSGGTKTGVNKGISYRRKTAGQKRESAERKKGNSVQKSDNKC
DFSTEDRSQTVDASVEVSNNVSFSSGIVDATLTGSTQKNGGTNVGRRVVPQDITSLVMTA
AGDPLISNEPESILEQTLPPQVAWVLCDDCEKWRCISVELANTLEETKGKWTCKDNTDKA
FADCSIPQEKTNSEINAELGISDEEDPSSVKANANEVEPSKLADVATSGRASWSPIKSNI
FLHRTRKTQTIDEIMVCHCKSMRDDHPGCGDQCLNRMLNIECVKGTCPCGDLCSNQRFQK
RKYAKFKWFRCGKKGYGLQLREDVSQGQFLIEYVGEVLDLSTYEARQKDYASRGQKHFYF
MTLNGGEVIDACAKGNLGRFINHSCEPNCRTEKWMVNGEVCIGLFAIRDIKKGEEVTFDY
NYVRVVGAAAKKCVCGXXXLNSEVIVQGDSDEEDFEPVVVRKNSQRVVNLNDSLSNASDM
KAAKHKDISVEREDVVVTCSSAVLEPQTGVLNEEDVCSSIPEVNPVNISLKSLDPMQLDN
TISTLISGIQALGDSELSSNSTQVEERICKSLTDIQPQEISLQASSTVNEVPSNYVLNSK
KSTTNPFEEKPNTTKPNSVKKSSHSRGTIKRGRSNMKHPVSDKTKTSTIGTGGCHFQGVE
EKLNELLDVDGGISKQKDATRGYLKLLFVTAAGGDVRGCASQSTRDLSLILDAVLKTKSR
KVLVDIINKNGLQMLHNIMKQNRGNFTRIPIIRKLLKVFEFLALAGILTLELINKPPPCT
GMESFKESILKLANHEDKLVHKIAREFRDKWIPRHIRRVEPSDRDDSKLDRHVPYHPWIQ
SPKLKRQQVSRERDTDAIVISAPDPSPTSSNKVDTHGEASSHSQQLSINVPLSDNSSARG
TKVRKRKSRWDTPSDVTSAGLQYLETSSKFMKCTLALSEQTSSLEVSKHKYGAERGDNRT
CCEVGSSQDLMQLDDERPPGFAGFANDEGPPGFLSNDEGPPGFLDDGPPGFLDEGPPGFV
DAEGPPGFEPHQKNHHSPFSSEAALITGEVFTGHPQEIYLSQMTVSFGMPVALMQQLGTP
ETGGSQTNQNWAVAPGMPFYPYPPLPSYPRGQPNPRQKRRRVHQTNDTIPSTSGEAPDMT
ETGFRNSQFNGRLRWPNKGYGRKFPRQQRWNDNPRFQRFWPHQKFGRGFRGNMRNGPHIL
EAGNVRSDLRGGLRPPDSVSNNGGFCSNFHKPHN
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcaccatggtttccatgctgtggtaggtttgccaacttctaattgccagctt
gattttgacaagtttaccaaagttgaagatgacaatgaattaggcagagataagcttgat
gttgtcaaatcactcaaacaagatgagcaacttggggagaaagatagggatagctctttg
actcaagaggcatctggtgagctgggtgagcgctcaggggtttcatctcaaattgcttct
gaaatgttggttgaaacagttagttacaaaaactcattggatccaggtacatcgccagat
tcagatgtttataatccggttatagatgttggtataatgacaagtgaaggtaacaattca
gctgatcaagttattggaaataaagatgttggtatcatcaccagtgaaggtgctgcttcc
acagagcaaatgggtcagaatgtgctagttcagggggccgtttctgatgatggccttcat
cctgctgtctctacttcttcaaacgcttgtataacttctttttctgttccatctctagat
tcaaatctatatgccaaagctaaaaatgagaagatgaagggtcaagtcggggaacaatca
tgtttgtcagaccatctttctgctctggagaagttccatgaaccagaaatcttgaataat
actaagaaacctacaaaacctacaaaacctggcaaatctaaacagaaaaaacaagatttc
agtaataaaaagaaccgatcatgttcaagatcccacaaaaagaccaataaaaaaggatct
aagtgcaagagtgttgctttcaaatcttctcttcctgagactgctgaattgcagcgccct
gaagaatttatgaaagcgccaaattatttggataattcagttttgcctggggaagaagcc
agcaatttgctacctgaagcatcgttgcatagttctaaaactgaaggacataagctttct
ggtggtactaagacaggtgttaataaaggcatatcatatcgtcgtaaaacagcagggcag
aaaagagaaagtgcagaaaggaaaaagggtaatagtgtacagaagtctgataacaagtgc
gatttcagtacggaggatagaagtcaaacagttgatgcatctgtggaggtcagcaataat
gtcagcttctcttctggaattgttgatgccacattgactgggtcaactcaaaagaacggt
ggaactaacgtggggaggagagttgtccctcaagatataacgagcttagttatgacagct
gcaggtgatccattaatatcaaacgaacctgaaagcattctagaacagacgctacctcca
caggttgcatgggtgctatgtgatgattgtgaaaagtggcgttgtatatcagttgaactt
gcaaatacattagaagaaaccaagggcaaatggacctgtaaggataacacagacaaggca
tttgctgactgctcaataccacaagagaaaacaaattcggaaataaatgccgagttaggg
atttcggatgaggaggatccttcaagtgtgaaggcgaatgctaatgaagttgaaccatct
aaattggcagatgttgcgacttctggtcgagcttcttggtctcccatcaagtctaatata
tttctgcatcgtacccgtaaaacccagaccatagatgagatcatggtgtgccattgtaaa
tctatgcgtgatgaccatccgggttgtggcgatcaatgtttgaaccggatgcttaatata
gaatgtgtcaaaggaacctgcccatgtggggatctttgttcaaaccaacggtttcaaaag
cgcaaatatgccaaattcaagtggtttcgttgtggaaagaaaggctatggtctacagttg
cgggaagatgtatctcaagggcagtttctcattgaatatgttggagaggtgcttgattta
tcgacctatgaagcccgacaaaaagattatgcttccagaggtcagaagcatttctatttc
atgacgttgaatggtggtgaggtaatagatgcctgcgcgaagggaaatttagggcgtttc
atcaatcatagctgtgagccaaactgtcgtacagaaaagtggatggtaaatggagaagtt
tgtataggactctttgcaatcagggatattaagaagggtgaagaggtgacatttgattac
aattatgtacgagtagttggtgctgctgccaaaaaatgtgtttgtggnnnnnnnnnattg
aactctgaagttattgtccaaggtgattcagatgaagaggactttgaacctgtggttgtc
cgcaaaaatagtcaaagagtggtaaatctaaatgattctctatctaatgcgagtgatatg
aaggctgccaaacataaagacatttctgttgagagggaagatgttgttgtcacatgctct
tctgcagtcctagagcctcaaactggtgtactaaatgaggaggatgtgtgcagttctata
cctgaagtgaatccagtgaacatttctttgaaaagtttagatcctatgcaattggataat
actatctccacactgatatctggcattcaggcattaggagactcagaactaagttcgaat
agcactcaagttgaagagagaatctgcaaatcattaactgacattcaaccacaagaaatt
tctctacaagcatcaagtactgtgaatgaagttccatcaaactatgttctgaatagcaag
aaatcaacaactaacccttttgaagagaagccaaatacaactaaaccaaattctgttaaa
aaatcatctcattcaagaggtacaattaaaaggggcaggtcaaacatgaaacatccggtc
tctgacaaaaccaaaacatcgacaataggcactggcggttgtcactttcagggagttgaa
gaaaaactcaatgagttgttagatgtagatggcggaattagcaagcagaaagatgcaact
agaggatatttgaagcttttgtttgtcactgcggcaggaggggatgttagaggatgtgca
tcccaaagcacacgggatctttcattgattcttgatgctgttctgaaaacaaagtcacgg
aaggttttggtagatataatcaacaaaaatggactgcaaatgctacacaatattatgaag
caaaatcgtggtaactttaccagaattcccatcatcaggaagcttcttaaggtatttgag
tttcttgcactcgcaggaatccttactctggagctcattaacaaacctcctccttgtact
ggaatggaaagcttcaaggagtcaatactgaagttagcaaatcatgaagataagctggtc
cacaaaattgcacgtgaattccgagataaatggattcctcgacacatcagaagagttgag
ccatctgatagagatgatagcaagttggatcggcacgtaccctatcacccttggattcaa
tcacctaaacttaaacggcagcaggtttccagggaaagggatactgatgcaattgtcatt
agtgcaccagacccttcaccaacatcctctaataaagttgatactcatggtgaagcctct
tcacatagtcagcaattgtccatcaatgtccctctgagtgataacagttcagcaagaggg
acaaaggtccgcaaaaggaaaagtaggtgggatactccatcagatgttaccagtgcaggc
ctacaatatttagaaactagttcaaagtttatgaagtgcacattggcactatcagagcaa
acttcttctctcgaagtttcaaagcacaaatatggggctgaaagaggggataatcgcacc
tgctgtgaagtcggtagttcccaggatttaatgcaacttgatgatgaaaggcctcctgga
ttcgctggattcgccaatgatgaaggacctcctggattcctaagtaatgatgaaggaccc
cctggattcctagatgatggaccccctggattcctagatgagggccctcctggattcgtt
gatgctgaagggcctcctggatttgagccccatcagaagaatcaccactctccattttct
tctgaagctgctttgattacaggtgaagtatttacaggtcatcctcaggaaatatacctt
tctcaaatgaccgtgtcatttggtatgccggttgctctcatgcagcaacttggaacccct
gaaaccggaggcagccagactaaccaaaactgggcagttgcacccggaatgcccttttat
ccttaccctccgttgccatcatatccaagggggcaacccaatcctaggcaaaaaaggcga
cgcgttcatcaaaccaacgacacaattccaagcacatctggggaagctccagatatgacc
gaaactgggtttaggaactcacagttcaacggtagattgcggtggcctaacaaaggatac
ggaaggaaatttccccgtcaacagaggtggaacgataacccgaggtttcagagattttgg
ccccaccaaaagtttggtcgcggatttcgaggtaacatgaggaacgggcctcacatttta
gaggcggggaatgtgaggagtgatctcagagggggcttgcgccctccagatagtgttagt
aataatggtggtttttgttcaaattttcataagccgcacaattag

DBGET integrated database retrieval system