KEGG   Asparagus officinalis (garden asparagus): 109829156Help
Entry
109829156         CDS       T05243                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00630  Glyoxylate and dicarboxylate metabolism
aof00710  Carbon fixation in photosynthetic organisms
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Module
aof_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aof_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aof_M00532  Photorespiration
aof_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:aof00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109829156
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109829156
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109829156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 109829156
NCBI-ProteinID: XP_020251881
LinkDB All DBs
Position
1
AA seq 179 aa AA seqDB search
MASSMMVSSAAAAARAAPAQTNMVAAFSGLKSTSAFPATRRASADLAKLPSNGGRVQCMK
VWPVEGIKKFETLSYLPTLSIEQLIKQIEYLIRNGWIPCLEFCHEGFVYRKYHASPGYYD
GRYWTMWKLPMFGCTDAIQVVKELDNCKAEYPTAFIRIIGFDNNRQVQCVSFIAYKPPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcgatgatggtctcctctgccgccgctgccgcccgtgccgccccggctcag
accaacatggtcgccgccttcagcggcctgaagtccacctctgcgttccccgccacccgc
agggccagcgctgacctcgccaagctcccaagcaacggcggaagagttcaatgcatgaag
gtgtggcctgttgagggcatcaagaagttcgagaccctctcctaccttcctaccctgtcc
attgagcagttgatcaagcagattgagtaccttatccgcaacggctggattccctgcctg
gaattttgccacgagggattcgtgtaccgtaaataccacgcctccccagggtactacgac
ggcagatactggacaatgtggaagctccccatgttcgggtgcaccgacgccatccaggtc
gtgaaggagctcgacaactgcaaggccgagtaccccacggcattcatccggatcatcgga
ttcgacaacaaccgtcaagtgcagtgcgtcagcttcatcgcctacaagccccctcagtaa

DBGET integrated database retrieval system