KEGG   Amycolatopsis orientalis: AORI_0923Help
Entry
AORI_0923         CDS       T02678                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aoi  Amycolatopsis orientalis
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AORI_0923 (glpA)
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AORI_0923 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
940247..941986
Genome map
AA seq 579 aa AA seqDB search
MASSQREAENSPARLGPLKREESWQRLGEDKFDLVVIGGGVVGAGTALDAATRGLRVALV
EARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTTIAPHLVKPVSFLYPL
THRVWERPYTAAGLLMYDTMGGARSVPGQKHLSRAGALRMVPALKRSALIGGIRYYDAQA
DDARHTMTVARTAAHYGAVVRTSTQVVGFLREADRISGVRVRDVEDGRETEIHASAVVNC
TGVWTDELQRLSGGRGRFRVRASKGVHIVVPRDRIVSESGMILRTEKSVLFVIPWRNHWI
VGTTDTDWNLDLAHPAATKHDIDYLLEHVNTVLATPLTHDDIEGVYAGLRPLLAGESEET
SKLSREHAVARVAPGLVAIAGGKYTTYRVMAADAVDAAAVDLPGRPQSSITDKVPLLGAD
GYHALVNQADHLAGEHGLHPYRVRHLLDRYGSMVHEVLALGEGRPELLKPLEHAPDYLGV
EVVYAASHEGALHLEDVLARRTRISIEYAHRGVDCAAQVATLVGEVLGWSKDEEKREVEV
YKARVDAERESQSQPSDEAADALRSAAPEARSGIIEPVS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagctctcagcgcgaagccgaaaacagccccgccaggctgggaccgctcaagcgg
gaagagtcttggcagcggctgggtgaggacaagttcgatctcgtcgtcatcggtggcgga
gtggtcggggcaggcacggcgctcgacgccgcgacacgcggcctgcgggtcgccctcgtc
gaagcgcgagacctcgcctcgggaacgtcgagccggtccagcaagctcttccacggcggg
ctgcgctacctcgaacagctcgaattcggtctggtgcgggaagctctgcgggaacgcgag
ctgatgctgacgacgatcgccccgcatctggtgaagccggtcagcttcctgtacccgctg
acccaccgcgtctgggagcgtccgtacaccgcggccggcctgctgatgtacgacacgatg
ggcggcgcgcggtcggtgcccggccagaaacacctgagccgcgccggtgcgctgcggatg
gtcccggcgctgaagcggtccgcgctgatcggcgggatccgttactacgacgcgcaagcc
gacgacgcgcgccacacgatgaccgtcgcccgcaccgccgcgcactacggcgccgtggtg
cgcacctccacccaggtggtcggtttcctccgcgaggccgatcgcatttccggggtccgc
gtgcgcgacgtcgaggacggccgggagaccgagatccacgcctccgcggtggtcaactgc
accggcgtgtggaccgacgaactgcagcgcctttccggtggccgcggccggttccgcgtg
cgggcgagcaagggcgtgcacatcgtcgtcccgcgcgaccggatcgtctcggaatcgggc
atgatcctgcgcaccgagaagtccgtgctgttcgtcatcccgtggcgcaaccactggatc
gtcgggaccaccgacaccgactggaacctcgacctcgcgcatcccgccgcgaccaagcac
gacatcgactacctcctcgaacacgtcaacaccgtgctcgcgacaccgctcacgcacgac
gacatcgaaggtgtctacgcggggctccggccgttgctcgccggggaaagcgaagagacg
tcgaagctttcgcgcgagcacgcggtcgcgcgtgtcgcgccgggactggtcgcgatcgcg
ggtggcaagtacacgacgtaccgggtgatggcggccgacgccgtcgacgccgcggccgtc
gacctgccgggcaggccgcagtcgtccatcacggacaaggtgccgctgctcggcgccgac
ggctaccacgcgctggtgaaccaggccgaccatctggcgggcgagcacgggctgcacccg
taccgcgtgcgtcacctgctcgaccggtacggctcgatggtgcacgaggtcctcgcgctc
ggcgaaggacggccggaactgctgaagccgctggagcacgctccggactacctcggtgtc
gaggtcgtctacgcggccagccacgagggcgcgcttcacctggaagacgtgctcgcgcgc
cggacgcggatctccatcgagtacgcgcaccgcggcgtcgactgcgccgcgcaggtcgcc
acgctggtgggtgaggtgctcggctggtcgaaggacgaggagaagcgcgaagtcgaggtg
tacaaggcgcgggtcgacgcggaacgggagtcccagtcgcagccgagcgacgaggccgcc
gacgcgttgcgctccgccgcgcccgaagcgcgctcggggatcatcgagccggtgagttga

DBGET integrated database retrieval system