KEGG   Bradyrhizobium oligotrophicum: S58_18490Help
Entry
S58_18490         CDS       T02484                                 

Definition
(GenBank) putative maleylacetoacetate isomerase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    S58_18490
Enzymes [BR:aol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S58_18490
Transporters [BR:aol02000]
 Other Transporters
  Pores ion channels [TC:1]
   S58_18490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2126672..2127325
Genome map
AA seq 217 aa AA seqDB search
MAKPTLTISSKNYSSWSLRGWLLAKFAGLDFDEVVVGPDDASARAEILLLSSSILVPCLR
HDGATIWDTLAIGEYLNETFPEAGLLPADRIERAHCRSISGEIHSGFTTLRASLPVNLKG
HFPGFKVWTRAQADIDRIWAIWHDCLDRSGGPFLFGPRGMADAMYAPVVTRFVTYDVKLE
PRLKAYADLVMAMPEMQEWIEAAKAEPEEIEELEVEY
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccgacattgaccatcagcagcaagaactattcgtcgtggtcgctgcgcggc
tggctgctcgcaaagtttgccgggctcgatttcgacgaggtcgtggtcggtccggacgat
gcctctgcgcgggcggagatcctgctgctgtcctcatcgatcctggtgccgtgcctcagg
cacgacggcgccacgatctgggatacgctggcgatcggggaatatctcaacgagaccttt
cccgaggccggcctgctgccggccgaccgcatcgagcgcgcgcattgccgctcgatatcg
ggcgaaatccattccggcttcacgaccttgcgcgcttcgctgccggtcaatctgaaaggg
catttcccgggcttcaaggtctggacccgggcgcaggccgacatcgatcggatctgggcc
atctggcacgactgtctagacaggtcgggcggcccgtttctgttcggcccgcgcggcatg
gcggacgccatgtatgcgccggtggtgacgcgcttcgtgacctatgacgtgaagctggag
cccaggctcaaggcttatgccgatctggtcatggcgatgcctgagatgcaggagtggatc
gaggcggccaaggccgagcccgaggagatcgaggagctcgaggtcgagtattag

DBGET integrated database retrieval system