KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1541Help
Entry
APP7_1541         CDS       T00717                                 

Gene name
tufB1
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
Translation factors [BR:apa03012]
 Eukaryotic Type
  Elongation factors
   APP7_1541 (tufB1)
 Prokaryotic Type
   APP7_1541 (tufB1)
Mitochondrial biogenesis [BR:apa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    APP7_1541 (tufB1)
Exosome [BR:apa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   APP7_1541 (tufB1)
  Exosomal proteins of breast cancer cells
   APP7_1541 (tufB1)
  Exosomal proteins of colorectal cancer cells
   APP7_1541 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1719382..1720566
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVPEWEEKILELAHHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKSG
EEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGTIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccccatgtaaacgtgggtacaatcggtcac
gttgaccatggtaaaacaactttaacagcagcaatcactaccgtattatcaaaacacttc
ggtggtgcggctcgtgcattcgaccaaatcgataatgcgccggaagagaaagcgcgtggt
atcaccatcaacacatcacacgttgagtacgatacggaaactcgtcactacgcacacgta
gactgcccgggacacgcggactatgttaaaaacatgattaccggtgcggcgcaaatggac
ggtgcaatcttagtagtagcagcgacagacggtccgatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggcgtaccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagtgcgtgaacttctttctcaa
tacgatttcccgggtgacgatacaccaatcgtacgtggttcagcgttacaagcgttaaac
ggcgtgccggagtgggaagaaaaaattcttgagttagcacaccacttagatacatacatt
ccagagccggagcgtgcaattgataaaccgttcttattaccaatcgaagacgtattctca
atttctggtcgtggtacggtagtaacaggccgtgttgaacgtggtatcatcaaatcaggt
gaagaagttgaaatcgtaggtatcaaagaaactacgaaaacaaccgtaactggtgttgag
atgttccgtaaattattagacgaaggtcgtgcgggggaaaacgttggtgcattattacgt
ggtacaaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccgggtacaattact
ccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggtggtcgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaacggacgtaacaggt
acaatcgaattaccggaaggtgttgagatggtaatgccgggcgacaacatcaaaatgact
gtgagcttaattcacccaatcgcaatggacgaaggtttacgttttgcgattcgtgaaggt
ggtcgtacagtaggtgcgggcgtggtagcgaaaatcatcaaataa

DBGET integrated database retrieval system