KEGG   Alcanivorax pacificus: S7S_03610Help
Entry
S7S_03610         CDS       T03580                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
apac  Alcanivorax pacificus
Pathway
apac00250  Alanine, aspartate and glutamate metabolism
apac00410  beta-Alanine metabolism
apac00640  Propanoate metabolism
apac00650  Butanoate metabolism
apac01100  Metabolic pathways
apac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apac00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S7S_03610
   00650 Butanoate metabolism
    S7S_03610
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S7S_03610
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S7S_03610
Enzymes [BR:apac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     S7S_03610
Amino acid related enzymes [BR:apac01007]
 Aminotransferase (transaminase)
  Class III
   S7S_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJD47144
UniProt: A0A0B4XGB2
LinkDB All DBs
Position
complement(769377..770630)
Genome map
AA seq 417 aa AA seqDB search
MSHLSPLLKQSSTVCADHGRGSYLFDRAGNSWLDFTSGIGVTATGHCHPDVVDAVREQAG
RLVHGQYTTVTHPNMLTLTDRLYEKLPGALDAIALFNAGSEAVEAALRLARHATGRANII
AFQGGFHGRTMAAASLTTSTTKVRTGFHPMMAGVCFSPFPHAYRYGWDEDTTTDFCLREL
DHLFLTQCAPDDTAAMIIEPVQGEYGYYPANRAFMQGLRERCDRYGILLIADEIQAGYGR
TGRFWSHQHFDVTPDILITAKGLASGFPLSAMAASEALMKQGLPGSQGGTYGANAVSCAA
ALATLQVIEQEALVDNARHQGEHLAAQLSALRQRHQCIDDIRGMGLMLGMEITDRHGAPD
GARAAALLQAAEAESLLLLRCGSHGQVVRWLPPLTVTRDEIDLAAQAFERALTATGG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagccacctgtcacccctgctgaaacaatccagcaccgtctgcgcggatcacggccgc
ggcagctatctgttcgatcgtgcaggcaatagctggctcgatttcacctccggcatcggc
gtcaccgccaccgggcactgccacccggatgtggtggacgccgtgcgcgaacaggccggg
cggctggtgcacgggcaatacaccacggtcacgcacccgaacatgctgacgcttaccgat
cggctgtacgaaaaactgcccggggcactcgatgccatcgccttgttcaatgccggcagc
gaagcggtggaagcggcgctgcggctggcccgtcacgccaccggtcgcgccaacattatc
gcgttccagggcggtttccatggccgcaccatggcggcggcgtcgctgaccacgtccacc
accaaagtccgcaccggctttcacccgatgatggccggcgtgtgtttcagcccgtttccg
cacgcctaccgctacggctgggatgaggacacgaccacggatttctgcctgcgcgaactg
gatcacctgttcctgacccagtgcgcgccggacgacaccgccgccatgatcatcgagccg
gtccagggcgaatacggctattacccggccaaccgcgcattcatgcagggcctgcgcgaa
cgctgcgaccgttacggtattctgctgatcgccgatgaaatccaggccggttacggccgc
accggtcgcttctggagccatcagcattttgacgtcaccccggatatcctgatcaccgcc
aaagggctggccagtggttttcccctgtccgccatggccgccagcgaagccctcatgaaa
cagggcctgcccggttcgcagggcggcacctatggggccaatgccgtctcctgcgctgcc
gcactggccaccttgcaggtgatcgaacaggaagcgctggtcgacaacgcccgtcatcag
ggcgaacacctggccgcgcagctgtcggcattgcgtcagcggcatcagtgcattgacgat
attcgcggcatgggcctgatgctcggcatggaaatcaccgatcgtcacggcgcacccgac
ggcgcccgcgctgcggcgctgctgcaggccgccgaagccgagagcctgttgctgctgcgg
tgcggcagccacggccaggtggtgcgctggctgccgcccctgaccgtcacccgcgacgaa
attgatctggcagcgcaggcatttgagcgcgcactcaccgccaccggcggctga

DBGET integrated database retrieval system