KEGG   Alcanivorax pacificus: S7S_06560Help
Entry
S7S_06560         CDS       T03580                                 

Definition
(GenBank) heme peroxidase
Organism
apac  Alcanivorax pacificus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-ProteinID: AJD47728
UniProt: A0A0B4XME6
LinkDB All DBs
Position
complement(1464458..1467205)
Genome map
AA seq 915 aa AA seqDB search
MAMTPWVTWPALTKFGTLGIMGALLVLAGQREDLLNNNMFDEEDWAGRNAAIVCDQRSLT
ARTEDGTCNILENPAEGSAHVNFGRNVNPSVAQAETLNDTLLVPNPREVSNLLMSRGDDF
KPATTLNFIATAWIQFMVHDWFDHGPRSDANPIEFPLPPGDALGSGTMSVQRTRPDPRVS
GTETTVTYENINTHWWDGSQLYGSDKATNDAVRSFIDGKLEVDADGRLPTEFLSGKPVTG
FNENWWVGLSMLHHLFTLEHNAIADMLKANNPGQSDQWLFDKARLINSALMAKIHTVEWT
PAILANPVLERAMYANWWGLGGDRDTRDRFQGDLDTLNNNLAQLGSLFSLVGIDTGLGDN
PTSSIEHALAGLVGSRTPNNYGVPYTLTEEFVSVYRMHPLLRDNVDIYDIGSNIVDTSIP
IQHTRDSNAEALLGDAGADRLWYSFGITHPGALTLNNYPDFMRNLSLPFVGDIDMAAIDI
LRDRERGVPRYNEFRRQIGLKPITRFEDLTSDPTLLANLKTLYSNDVEMIDTLVGQLAEE
TRPEGFGFGETSFQIFILNASRRLMTDRFFTTDYTDAVYTAAGIDWVEDNTMVDVIRRHF
PSLASSLAGMDNAFKPWGLNMPADYQSWSAGAKQDHLWVNGALRTSYAAGSVPAIEPIDI
GGLINSVLWTKVRDVTDVTPPGYSKPIHPRGALAKVQFVPSAGHPFTGLFKGADHGLLRL
SVTGDPSDRGFAPGLALKLFVDGRRSENISALYTLSGQGSNHNIFANEMSNYVQPEVNET
LGTTALFSLVSTKPTLLVMSDMAKVNQDGSGVGSVKAPTQIYFVPNTSLRNAISTAPHDF
RDDLTTLPAGTRVYDVYGTSQAIRTSLFPWVTERYARERRDSAVKIGELVTTSAFTLSQF
GDTGIFFKHQRYEDR
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaccccctgggtgacctggccggcgctcaccaaattcggcaccctgggcatc
atgggtgcgttactggtgctggccggacagcgtgaagacctgctcaataacaacatgttc
gacgaggaagactgggcgggcagaaatgccgccatcgtctgcgaccagcgcagcctgacc
gcccgtaccgaggacggcacctgcaatattctggaaaaccccgccgaaggctccgcccac
gtcaacttcgggcgcaacgtcaatccgagcgtggcacaggcggaaaccctcaacgacacg
ctgctggtgccgaacccgcgcgaagtcagcaacctgctgatgtctcgcggcgacgacttc
aagccggccacgacgctgaactttatcgccaccgcctggatccagttcatggtgcacgac
tggttcgatcacggtccgcgcagcgacgccaacccgatcgaatttccgctgccaccgggt
gatgccctcggcagcggcaccatgtccgtgcagcgcacgcgcccggacccgagggtcagc
ggcacggaaaccaccgtgacctatgaaaacatcaatacccactggtgggacggctcacaa
ctctatggcagtgacaaggccaccaacgacgccgtgcgctcgttcattgacggcaaactg
gaagtcgatgccgacggccgcctgccgaccgaatttctcagcggcaaaccggtcaccggc
ttcaacgaaaactggtgggtcggcctgagcatgctgcatcacctgttcacactggaacac
aacgccatcgccgacatgctcaaggccaataatccgggccagtctgatcaatggctgttc
gacaaggcacgtctgatcaactcggcattgatggcgaagattcacaccgtggaatggacc
ccggcgatcctcgccaacccggtactggaacgcgccatgtacgccaactggtggggcctg
ggcggcgaccgcgacacgcgcgacagattccagggcgacctggacacgctgaacaataac
ctggcgcaactcggcagcctgttcagtctggtcggcatcgacaccggcctgggtgacaac
ccgaccagctcgattgaacacgccctggccggcctggtcggctcgcgcacgccgaacaac
tacggcgtgccctacacgctgaccgaagaattcgtgtcggtgtaccgcatgcacccactg
ctgcgcgacaatgtcgatatctacgacatcggttccaatattgtcgacacatcgataccg
atccagcatacccgcgacagcaacgccgaagcgctgctcggcgacgctggcgcagaccgc
ctgtggtactcgttcggcatcacccacccgggcgcgctgacactgaacaattacccggat
ttcatgcgcaacctgtcgctgccgtttgtcggcgatatcgacatggcggcgattgatatt
cttcgcgaccgggaacgcggcgtaccgcgctataacgagttccgccgccagatcggcctg
aagccgatcacccgtttcgaagacctgaccagcgacccgacactgctggcaaacctgaaa
acgctgtacagcaacgacgtcgaaatgatcgataccctggtcgggcaactggcggaagaa
acccgtccggaaggcttcggctttggcgaaacctcgttccagattttcattctcaacgcc
tcacggcgcctgatgaccgaccgctttttcaccactgactacaccgatgcggtctacacc
gccgccggcatcgactgggtggaagacaacaccatggtcgacgtgatccgccgtcacttc
ccgtccctggccagcagcctggccggcatggacaacgccttcaagccctggggcctgaac
atgccggcggactaccagagctggagtgccggcgcgaaacaggaccacctgtgggtcaac
ggcgcactgcgcaccagctatgccgccggcagcgtgccggccatcgagccgatcgacatc
ggtggtttgatcaattcagtgctgtggaccaaagtgcgcgacgtcaccgacgtgaccccg
ccaggctacagcaagccgatccacccgcgcggcgcactggccaaagtacagttcgtgccc
agtgccgggcaccccttcaccggcctgttcaaaggcgctgaccatggcctgctgcggctg
tcggtcaccggcgacccgtccgaccggggctttgcaccggggctggcgctgaaactgttt
gtcgatggccggcgttcggaaaacatttccgcgctgtacacgctcagcggccagggcagc
aaccacaatatctttgccaacgaaatgtccaactacgtgcagccggaagtgaacgaaacc
ctgggcaccaccgcactgttctcgctggtatcgaccaaaccgacgctgctggtgatgagc
gacatggcaaaggtgaaccaggacggctccggggtgggcagtgtgaaagcaccgacgcaa
atctactttgtgccgaacaccagcctgcgcaacgccatcagcaccgcgccacacgatttc
cgcgacgacctgaccaccctgccggccggcacccgcgtgtatgacgtgtacggcaccagc
caggcgatcagaacctcgctgttcccctgggtgacggaacgctacgcccgtgagcggcgc
gacagcgcggtgaagatcggtgagctggtcaccacgtccgcattcaccctgtcgcaattt
ggcgataccggtattttcttcaagcatcagcgttacgaagaccgctga

DBGET integrated database retrieval system