KEGG   Alcanivorax pacificus: S7S_08695Help
Entry
S7S_08695         CDS       T03580                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
apac  Alcanivorax pacificus
Pathway
apac00020  Citrate cycle (TCA cycle)
apac00270  Cysteine and methionine metabolism
apac00620  Pyruvate metabolism
apac00630  Glyoxylate and dicarboxylate metabolism
apac00680  Methane metabolism
apac01100  Metabolic pathways
apac01110  Biosynthesis of secondary metabolites
apac01120  Microbial metabolism in diverse environments
apac01130  Biosynthesis of antibiotics
apac01200  Carbon metabolism
Module
apac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apac_M00012  Glyoxylate cycle
apac_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:apac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S7S_08695
   00620 Pyruvate metabolism
    S7S_08695
   00630 Glyoxylate and dicarboxylate metabolism
    S7S_08695
  Energy metabolism
   00680 Methane metabolism
    S7S_08695
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    S7S_08695
Enzymes [BR:apac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     S7S_08695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJD48153
UniProt: A0A0B4XNU4
LinkDB All DBs
Position
complement(1939477..1940457)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALKGVAMELDDC
AFPLLAGIVQTDDPKVAFKDAQYALLVGARPRGPGMERKDLLEANAAIFSVQGKAINEVA
SRDIKVLVVGNPANTNALIAQRNAPDINPRQFTAMTRLDHNRAMAQLAAKVGKTVNDVKK
MTIWGNHSSTQYPDLHHATVDGKTAVDLVEQDWYEGTYIPEVQQRGAAIIKARGASSAAS
AASAAIDHMRTWALGTADGDWVSMGIYSDGSYGIQEGLIYSFPCTCKNGDWAIVQGLEVN
DFSRGRMEATEKELAEERDAVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacccgtacgcgttgcagtcactggtgccgcaggccagatcagctattccctg
ctgttccgcattgcctccggcgacatgctcggcaaagaccagccggtgatcctgcaactg
ctggaaatcaccccggccctggaagccctcaagggcgtggccatggaactggacgactgc
gccttcccgctgctggccggtatcgtgcagaccgatgacccgaaagttgctttcaaggat
gcccagtatgccctgctggtcggcgcccgtccgcgcggcccgggcatggagcgtaaagac
ctgctcgaagccaacgccgcgattttctcggtccagggcaaggccatcaacgaagtggcc
agccgcgacatcaaggtactggtggtcggcaacccggccaacaccaacgccctgatcgcc
cagcgcaacgcgccggacatcaacccgcgtcaattcaccgccatgacccgcctggaccac
aaccgtgccatggcgcaactggcggccaaagtcggcaagaccgtgaacgacgtgaagaaa
atgaccatctggggcaaccactcctccacccagtacccggacctgcaccacgccaccgtg
gacggcaagactgccgtggatctggttgaacaggactggtacgaaggcacctacattccg
gaagtacaacaacgcggcgcggccatcatcaaggcccgtggtgcctcgtctgctgcctcc
gctgcgtctgccgccatcgaccacatgcgcacctgggcactgggcactgccgacggcgac
tgggtctccatgggcatctacagcgacggttcctacggtattcaggaaggcctgatctac
tccttcccgtgcacctgcaagaacggcgactgggcaatcgtccagggcctggaagtgaat
gatttctcccgtggccgcatggaagccaccgagaaagagctggctgaagagcgtgatgcg
gtgaagcatctgctgccgtaa

DBGET integrated database retrieval system