KEGG   Candidatus Puniceispirillum marinum: SAR116_2375Help
Entry
SAR116_2375       CDS       T01207                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
apb  Candidatus Puniceispirillum marinum
Brite
Translation factors [BR:apb03012]
 Eukaryotic Type
  Elongation factors
   SAR116_2375
 Prokaryotic Type
   SAR116_2375
Mitochondrial biogenesis [BR:apb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SAR116_2375
Exosome [BR:apb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SAR116_2375
  Exosomal proteins of breast cancer cells
   SAR116_2375
  Exosomal proteins of colorectal cancer cells
   SAR116_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2590924..2592114
Genome map
AA seq 396 aa AA seqDB search
MSKEKFDRSKPHCNIGTIGHVDHGKTTLTAAITKVMAEAGGAEFQDYDQIDKAPEERARG
ITISTAHVEYETEQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALCVFMNKVDQVDDEELLELVEMEIRELLSSYEFPGDDIPIVKGSALTALE
GGDDTIGSGAIKELMAAVDAYIPQPERPKDQPFLMPIEDVFSISGRGTVVTGRIERGIVN
VGEEIEIVGLKDTQKTTCTGVEMFRKLLDQGEAGDNVGVLLRGTKREEVERGQVLCAPGS
ISPHTEFKAEAYILTKDEGGRHTPFFSNYRPQFYFRTTDVTGSVELPSGTEMVMPGDNIA
MTVTLIAPIAMDEGLRFAIREGGRTVGAGVVATVVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggaaaagtttgatcgttccaagccacattgtaacatcggaacgattggtcac
gttgaccatggtaagacgacattgacagcagcgatcaccaaggtgatggcggaagctggc
ggcgcagagtttcaggattacgaccagattgacaaggcgcctgaagagcgtgcgcgtggt
atcaccatttcgacagcgcatgttgaatatgagacagagcagcgtcattacgcgcatgtt
gattgcccgggtcacgccgattatgtgaagaacatgatcactggtgcggcgcagatggat
ggtgcgattttggttgtatcagcggctgatggcccgatgccacagacccgcgagcacatt
ttgctggcgcgtcaggttggtgtgccggctttgtgcgtattcatgaacaaggttgatcag
gttgacgatgaagagttgcttgagcttgttgagatggaaatccgcgaattgctgtcatca
tacgaatttccaggcgacgatattccgattgtcaaaggttcggcattgaccgcacttgag
ggtggtgatgatacgattggttctggtgcgatcaaggaattgatggcggcggttgatgcg
tatattccccagccagagcgtccgaaggatcagccattcctgatgccgattgaggatgtg
ttctcgatttcgggtcgtggtacggttgtgaccggacgtattgagcgcggcattgtgaat
gttggcgaagagatcgagattgttggtctgaaagacacacaaaagacgacctgtacgggt
gttgagatgttccgcaagctgcttgatcagggtgaagctggcgataatgttggtgtgttg
cttcgtggtaccaagcgtgaggaagttgagcgtggtcaggttctttgtgcgcctggttca
atctcaccacataccgagttcaaggccgaggcttatatcctgaccaaggatgagggtggt
cgtcatacgccgttcttctctaactatcgtccacagttctatttccggacgacggatgtg
actggttcggttgaactgccatcaggcaccgaaatggtgatgccaggtgataatattgcg
atgaccgtgaccttgatcgcgccgattgcgatggatgaaggcttgcgctttgcgatccgc
gaaggtggccgcaccgtgggtgctggtgtcgtcgcaacagtggtaaaataa

DBGET integrated database retrieval system