KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_09310Help
Entry
APA12_09310       CDS       T01814                                 

Definition
(GenBank) translation elongation factor Tu (EF-TU)
  KO
K02358  
elongation factor Tu
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Brite
Translation factors [BR:apg03012]
 Eukaryotic Type
  Elongation factors
   APA12_09310
 Prokaryotic Type
   APA12_09310
Mitochondrial biogenesis [BR:apg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    APA12_09310
Exosome [BR:apg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   APA12_09310
  Exosomal proteins of breast cancer cells
   APA12_09310
  Exosomal proteins of colorectal cancer cells
   APA12_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
974585..975775
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAYDQIDAAPEERARG
ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDVPIIKGSALVTLE
DGDPEIGENRVRDLMDAVDSYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVIN
VGDEIEIVGLKPTTKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA
MEVELIAPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaatttgagcggaataaaccgcactgcaacatcggcaccattggtcac
gttgaccatggcaagacctctctgacggcagcgatcaccaagacgcttgcaaagaagggt
ggcgctgaattcaaggcgtatgaccagatcgacgctgctccggaagaacgcgctcgcggt
atcaccatttccacagcacacgtggaatatgaaaccgacaaccgtcactatgcgcacgtt
gactgccccggacatgctgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcaatcctggttgtgtccgcagctgacggcccgatgccgcagacccgtgaacacatc
ctgcttgctcgtcaggttggtgtgcctgctctggttgtcttcctgaacaaggttgaccag
gttgacgatccggaactgcttgaactggttgaaatggaagttcgtgaacttctgtcttcc
tatcagttccctggcgacgatgtgccgatcatcaagggttccgctctggtaactctggaa
gatggtgatccggaaatcggtgaaaaccgtgttcgcgatctgatggacgcagttgactcc
tacatcccgcagccggaacgtccggttgaccgtccgttcctgatgccgatcgaagatgtg
ttctccatctctggtcgtggcaccgtggtaacgggtcgtgtagaacgcggcgtgatcaat
gttggtgacgaaatcgaaatcgttggtctgaagccgacgacgaagacaaccgtaaccggc
gttgaaatgttccgtaagctgcttgatcgcggtgaagctggtgacaacatcggcgctctg
ctgcgtggcacgaagcgtgaagatgtggaacgtggtcaggttctggcaaagccaggctcc
atcacgccgcataagaagttcaaggcagaagcttacatcctgacgaaggaagaaggtggc
cgtcatacgccattcttcaccaactatcgtccgcagttctatttccgtacgactgacgtg
acgggtgttgtgcacctgccagaaggcaccgaaatggtgatgccgggcgacaactgcgct
atggaagtcgagctgattgctccgatcgccatggacgaaggtctgcgtttcgctattcgc
gaaggtggccgcacggttggtgctggcgttgtttcctccattatcgagtaa

DBGET integrated database retrieval system