KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_24990Help
Entry
APA12_24990       CDS       T01814                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
apg00473  D-Alanine metabolism
apg01100  Metabolic pathways
apg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    APA12_24990
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    APA12_24990
Enzymes [BR:apg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     APA12_24990
Peptidoglycan biosynthesis and degradation proteins [BR:apg01011]
 Precursor biosynthesis
  Racemase
   APA12_24990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAI21873
LinkDB All DBs
Position
complement(2704242..2705387)
Genome map
AA seq 381 aa AA seqDB search
MAVVNTVSSSARTLWPASRAGAVLTVNLSAIAENYRYLKSRLGKTACAAVVKADAYGLGV
AQVAPVLEKAGAEHFFVAHVDEGLALRPFLSPHTSVTVLHGPRPDAAEVCVRNNLRPVLN
SLEQVAVLRDLAAKMDKPLDVAIQLDTGMSRFGLSEADIHKLVASPELLKGLFVSLVMSH
LACADTPQNPANTMQRERFEAYARILPQAALSLSASSGIFLGPQFHFDLVRPGAALYGVA
PQNEGDNPLKPVVGLQAHILQIRHLSKGDRVGYGLTWQAHGPCRVATIATGYADGFARAG
AAAGCAWYKGYRLPILGRISMDSMTVDLSAVPEGLLEEDSMVELLNESYGVDAVAKAEGT
IGYEVLTSLGRRYHRVYAAAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttgtgaatactgtttcgtcctcagccagaacattgtggccggcatctcgcgcg
ggggctgttcttacagtcaacctgtctgccattgctgaaaattaccgctatcttaaaagc
cgactaggcaaaacagcgtgtgccgcagtggttaaggcggatgcctatgggctgggtgtt
gcgcaggtggcgcctgttttggaaaaagcaggtgcagaacatttttttgttgcgcatgta
gatgaaggacttgccctcaggccatttctctctcctcacacatcggtaacagtgttgcat
gggcctaggcctgatgctgctgaggtatgtgtacgcaacaatctgcggcctgttctgaac
agtttggaacaagttgctgttttgcgagatctggcagccaaaatggataagcctctggat
gtggctattcagcttgatacgggcatgtctcgttttgggctttcagaggcggatattcat
aaactggtggcgtctccagagcttctgaaaggcttatttgtcagtctggtgatgagtcat
ctggcgtgcgcagatacaccgcaaaatccagcaaacaccatgcagcgcgaacggtttgag
gcatatgcccgcatactgccgcaagcggcattaagcctttctgcatcatccggcattttt
ctggggccacagtttcattttgacctcgtgcgccccggagctgctttatatggcgtggca
ccacagaatgagggtgataacccgctcaagcctgtggttggcctgcaagcgcatattctg
caaattcgtcatttatccaagggagaccgggtcggttacgggttgacatggcaggctcat
ggtccatgccgtgttgccactattgctaccggttatgcagatggttttgcccgtgccggg
gctgccgctgggtgcgcttggtataagggctatcggctgccaattctgggccgaatttcc
atggattccatgactgttgatctttctgcagtgcccgagggtctgttggaagaagacagc
atggtggaacttctgaatgagtcgtacggcgtagatgctgtggccaaagcagaaggcaca
attggctacgaagtactgacatctctggggcggcgttatcatcgcgtttacgcagcggct
gcctga

DBGET integrated database retrieval system