KEGG   Acyrthosiphon pisum (pea aphid): 100165681Help
Entry
100165681         CDS       T01076                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Translation factors [BR:api03012]
 Eukaryotic Type
  Elongation factors
   100165681
 Prokaryotic Type
   100165681
Mitochondrial biogenesis [BR:api03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100165681
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100165681
  Exosomal proteins of breast cancer cells
   100165681
  Exosomal proteins of colorectal cancer cells
   100165681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 100165681
NCBI-ProteinID: XP_001948492
APHIDBASE: ACYPI006613
UniProt: J9K1I1
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MATMLKTSKLICYTLPKNKSPAQLNRYFQTLRKYNVPLQRCLNDVLRRQNAVGPVVGCAR
MYAAPSEKKVFQRVKPHCNIGTIGHVDHGKTTLTAAITKILSTKKMAKMKQYADIDNAPE
EKARGITINVAHVEYETEARHYSHTDCPGHADYIKNMITGTNQMDGAILVVAATDGAMPQ
TREHLLLAKQIGIGHIIVFINKVDAADSEMVELVEMEIRELLSEMGFDGENLPVIKGSAL
CALEGKEPEIGEKAIDALLAEVDKYVPQPIRDLDKPFMLPVEHVYSIPGRGTVVTGRLER
GIIKKGNECEFVGYNKVIKSTITGVEMFHKILEEAQAGDQLGALIKGTKRDDLRRGMVLA
KPGTVKMQDFVSTQVYVLNKDEGGNGKPLVPYQQMQMYSKTWDCACQLNIVGKEMVMPGE
DCSVELKLIRPMVLEKGQRFTLRVAGSTVGTGVITEIKKRLLDEERRGLLEGKKAREKKN
AE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccacgatgttgaagactagtaaattaatctgttacacgctgcccaagaataaatcg
cctgcacagctgaacagatactttcaaacgctgcgcaaatacaatgttcccctgcagagg
tgcctaaacgacgtcttacgaagacagaatgctgtcggcccggtcgtgggttgtgctcga
atgtacgctgcaccatctgaaaagaaagtcttccagagggtcaaaccgcattgcaacatt
ggcactattggacacgtagatcacggcaaaaccacactcacggctgccatcactaaaatt
ttatcgacaaaaaaaatggctaagatgaaacaatatgctgacattgataacgcacctgaa
gaaaaagcccgtggaatcaccattaacgttgctcatgttgaatatgaaactgaagctaga
cattacagccacactgactgcccaggacatgctgattacattaagaacatgatcactgga
acaaatcaaatggatggagctattttagtagtagctgcaactgatggtgctatgccccaa
accagagaacatttattattagctaaacaaataggaatcggtcatattattgtattcatt
aataaagtcgatgcagctgattcggaaatggttgaattagttgaaatggaaattagagaa
ctactgagtgaaatgggttttgatggcgaaaatttaccagttattaaaggttcagcacta
tgtgcccttgaaggaaaagaaccggaaattggagaaaaagctattgacgctctactagct
gaagtagataaatatgttccacaaccaatacgtgatttagataaacccttcatgttgcca
gttgaacatgtttactccattccaggacgtggcacagtggtaactggcagattagaacgt
ggcataattaaaaaaggaaatgaatgtgaatttgttggttataacaaagttataaaatct
acaatcactggagttgaaatgttccacaaaattcttgaagaggctcaagcaggagatcag
ctaggagctttaattaaaggtacaaaacgagatgatttaagacgtggcatggtattggcc
aaaccaggaactgtcaaaatgcaagactttgtctccactcaggtgtatgtgttaaacaaa
gatgaaggtggaaacggtaaaccacttgtaccctaccaacaaatgcaaatgtactcaaag
acttgggattgtgcttgccaattgaatattgttggcaaagagatggttatgcctggtgaa
gattgctctgttgagttgaagttgatcagacccatggttctggaaaagggacaacgattc
acgttgcgtgtggctggttctacagttggaactggagtgattactgaaattaagaaaaga
ttattagatgaagaaaggcgaggattgttggaaggtaaaaaagcacgagaaaagaaaaat
gctgagtag

DBGET integrated database retrieval system