KEGG   Acyrthosiphon pisum (pea aphid): 100165877Help
Entry
100165877         CDS       T01076                                 

Definition
(RefSeq) uncharacterized LOC100165877
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100165877
Enzymes [BR:api01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100165877
Chromosome [BR:api03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100165877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
APHIDBASE: 
LinkDB All DBs
Position
Un
AA seq 1568 aa AA seqDB search
MSSSSPPVDCQKPVKVKSRWTQSCQIEMMMEESQSSLDMSDTVTDVSLSDSNDSTDYSSE
FNSLELRKSRRNSNNRTNYRQSNQKKQKISSKNVIAKEHKEKQLSNMSDNDQEDKFKYNI
SQESFIKRNTSVDWNTISFFQSKSVNNISENIDKLPSKPIRRASVPWKFKFSFTKDLKDN
IRLLEKDDYYNLSNAIKYLNLNKMQLSEDKKLTQKENTINKNTSQQSYCINVCNLNRRDF
DGLSNKILNIEVSSENKLKQSHELNMDGKHYNEKYQNTDLEVPKSFLFKSKNLKCNPIYN
LREIRSKSCDSILKKTYYSFKRSKSYDDLNQLKDSVIDGFKLQKPEKKSPKKKRRQSKRI
KPKNNYIEILDDMKVPEINYNRVGDEIYKEHKNQLLEARINDIEFDEKLKATNFTLVDEN
VYRPNRQTLKSYPPSEIPGLRKLKQRIISGDINDYCECTLSKEDIIEGNTGCDDRCLNRL
LKVECGLGCSLKRYCTNKQFQNKQFKKTNIIKTDNKGYGICAVEDIPKGALISEYVGEVI
DYNEMCNRLTKKEYKNLNYMVQLNPDEIIDSTSKGNVTRFINHSCDPNSVGEKWHVLGQS
RIGFFSTRHIEKGEEITFDYSFQIFGDGAQICYCGSSKCRGYINKSSQIADQNSSEDSES
ANENVFVSKPEKKDRKKRNLENRTTYNDENKLRELGRQLTEIAKLKTGLKADQEMATLNL
NRLMVHITDSVSRLHVLTFIREHDMNKRLFMDFSGLSIIHNWMTSNENESFKLMILEILA
ELPITNRNTITKSKVLDVVAEWAKIPQDVKTKIESLEYAVTEIKNHCQEIDNLLPNDNEI
KNSLVEKSRALWKKWIVLKMVFKIPKKIDQHKPTTDINSCKLIDDCYPSPMDISSLDRKT
FRYSNKYVNKVRNKHATSLDRMKLRKEYKFKVDKERQKMFRKKVMDEWYEKVDGVVKKKP
DENYLQHHQTINFLNSTLNNNNGISEKTRWDSTSQATHVDQNSIINYGGHTPCLKNYMPP
QAVQQAFIQFPQYSYTQSQVFSDCHVVNQPTLYCTPSPLTSSQPLETQLQNMAKSNNKHV
NQNIESPVLSPTKHLLKLAETNVFNLINDSLRKHYNPKKTNVVETEMKHSKKSCTRVVQS
GADLLARIKVISNSFKNQPSKLITVKNLKQKNYNTKLEKVPSSDIKLKSICDENKRIVFI
NEETGVTSNTLSEDLLPTPKTIQVSKNNKFANAIFNSLLKKVLEPENENSVLKKFVSKNL
NSNVITYHETDKEIELYKNMKPKVLKKIVGHVKTKNGFVAVMKRQWGIKLKGLKRNRDEI
PATKRNIMRKGSIHRLALKNCLVNTTKSALKRHSSMNVNDYLKRPKEKRVTFWIEGETSP
NLPHSEPSTSAIQSGDNSQIPGLDTTNDQIITPIVAKFKATRNRRISLRDKSTELEQLRS
QRNHKIPISMMSLSVDVLKLIPDNRKEMKKIIDYYHSMATVIVKTLGSYAKKTCQQGRIR
SDEDFKYLAKKINENVLLKELQLKKVDKLKISDSTKDKVAEYIRKYMSRFGEAYKRKPSE
QTNHHKPK
NT seq 4707 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctagtagtcctccagtggattgtcaaaagcctgtaaaagtcaaatctcgctgg
actcaatcttgtcagatagaaatgatgatggaagagtcacagtcttcattagatatgtct
gatactgttacagatgtttcattaagtgattcaaatgatagtacagattatagttctgaa
tttaactctttggaattaagaaaatctcgtaggaatagcaataacagaacaaactataga
caatcaaatcagaaaaaacaaaaaatctcttccaaaaatgttattgcaaaagaacataaa
gagaaacaattgtctaatatgtctgacaatgatcaggaagacaaatttaaatacaatatt
tcacaagaatcttttattaaaagaaatacttcagtggactggaacactatttcatttttt
caatcaaagagtgttaataatataagcgaaaatattgataaattaccatcaaaacctatt
cgtcgagcctctgtaccatggaaattcaaattctcatttacaaaagatttaaaggataat
attaggttattagaaaaagatgactattataatctttctaatgctatcaaatatttaaat
ttgaataagatgcaattaagtgaagataaaaaattaactcaaaaagagaatacaataaat
aaaaatacttcccaacaatcatattgtataaatgtctgtaatttaaaccgtagagatttt
gatggtttaagtaataaaatattaaatattgaagtatcttcagaaaataagcttaagcaa
tcccatgagttaaatatggatggaaagcactacaatgaaaaatatcaaaatactgatttg
gaggtacctaaatcgtttttatttaaatcgaaaaatttgaaatgtaatcctatctataat
cttagagaaattcgttccaaaagttgtgattctatattgaaaaaaacatattattcattt
aaacgcagtaaaagttatgatgatttaaatcaattaaaagattctgtgattgatggtttt
aaattacaaaaacctgaaaaaaaatctccaaaaaaaaaaagacgacagtcaaaaagaatt
aaacctaaaaataattatatagaaatacttgatgatatgaaagttccagaaattaattat
aatagggtaggtgatgaaatttacaaagaacacaaaaatcaactacttgaagcaagaatt
aatgatatagaatttgatgaaaaattaaaagctaccaattttacattagttgatgaaaat
gtatacagacctaataggcagactttgaaatcctatccaccttctgaaattcctgggtta
cgtaagctaaaacaacggataatatctggggacataaacgattattgtgagtgtacatta
tctaaagaagatataattgaaggaaatacaggttgtgatgatagatgtctcaatcgactg
cttaaagttgaatgtggtttgggttgttctcttaaaagatattgtactaataaacaattt
caaaataaacaattcaagaaaactaacattattaaaactgacaataaaggttatggaatt
tgtgctgttgaagatattcccaaaggtgctctaattagtgaatatgttggtgaagttatt
gattataacgaaatgtgtaatcgcctaacaaaaaaagaatataaaaatctaaattatatg
gttcaattaaatccggatgaaattatcgattccacttcaaaaggaaatgtgactaggttt
attaatcatagctgtgatccaaattcagttggtgaaaaatggcatgtattgggtcaatct
cgtattggtttctttagcactcggcatattgaaaaaggcgaagaaattacatttgattat
agttttcaaatatttggagatggtgctcaaatttgttattgtggttcatcaaaatgtcgt
ggatacatcaataaatcatctcaaattgctgaccaaaacagttctgaggatagtgaaagt
gctaatgaaaatgtttttgtgtcaaaacctgagaaaaaagatcgaaaaaaaagaaatttg
gaaaataggacaacttataatgatgaaaataaattgagagagttgggcagacaattaaca
gaaattgccaaattaaaaactggattaaaagctgatcaagaaatggcaacattgaatttg
aatagacttatggtacacattacagacagcgtcagtcgattacatgttttaacatttata
agagaacatgatatgaacaaaagactatttatggatttcagtggacttagtattattcat
aactggatgacttcaaatgaaaatgaatcatttaaattaatgattttagaaatcttagca
gagttaccaatcacaaatagaaatacaattactaaatctaaagtactagatgttgttgct
gaatgggcaaaaataccacaagacgtcaaaactaaaatcgaaagtttagagtacgctgtt
acggaaattaaaaatcattgtcaagaaattgataacttactgccaaatgataatgaaata
aaaaatagtctggtagaaaaatctagagctttgtggaaaaagtggattgtattgaaaatg
gtgtttaaaattcctaaaaaaatagatcaacataaaccaactacagatataaattcatgt
aaacttattgacgattgttatccatctcctatggacatatcaagtttggatcgaaaaacg
tttagatattcaaataaatatgtaaataaagtacggaataaacatgctacatctttagat
cgtatgaaattgagaaaagaatataaatttaaagtggataaagaacgccaaaaaatgttt
aggaaaaaggtgatggatgaatggtatgaaaaagttgacggagtagtaaaaaagaaaccc
gatgaaaattacttacagcatcatcagacaataaatttccttaattcaacattaaacaat
aataatggaattagtgaaaaaacaagatgggattctacttcacaagcaacacatgttgat
caaaattcaataatcaattatggtggacatactccttgtttgaagaattacatgccacca
caagcagtacaacaagcatttattcaatttccacagtattcttatacacagtctcaagtt
ttctctgattgtcatgtagttaatcaaccaacattgtattgtactccttcaccactgaca
tctagtcaaccattggaaacacaactgcaaaatatggctaaatcaaacaataaacatgtt
aatcaaaatattgaatcacctgttctatctccaacaaaacatctacttaaattagctgaa
actaatgtctttaatttgatcaatgacagtttacgcaagcattataatcctaaaaaaaca
aatgttgttgaaacagaaatgaaacattccaagaaatcttgtacaagagttgtacaatct
ggtgcagatttattagcaagaattaaagttattagtaattcttttaaaaatcagccatca
aaattaattacagttaagaacttgaaacaaaaaaattataatacaaaacttgaaaaggta
ccttcgtctgatataaagttgaaatctatttgtgatgaaaataaaagaattgttttcatc
aacgaagaaaccggtgtgacttctaacacattaagtgaagatctattgccgactccaaaa
actattcaagtatcaaaaaataataaatttgcaaatgccatatttaattctttattaaaa
aaggtgttagaacctgaaaatgaaaactcagtactaaaaaaatttgtttcaaaaaatctc
aactcaaatgttatcacatatcatgaaaccgacaaagaaattgaattgtataagaatatg
aaaccaaaagttttaaaaaaaatagttggtcatgtaaaaactaaaaatggttttgtagct
gttatgaaacgacaatggggaattaaactgaaaggtttaaaaaggaaccgtgatgaaata
ccagctacaaaacgtaatataatgcgtaagggtagtatacatcgtttagcattgaaaaat
tgtcttgtcaatacaacaaaatcagcattaaagagacatagtagtatgaatgtgaacgac
tatttaaaaagacctaaagaaaaaagagttacattctggatagaaggtgagacatcacca
aatttgccacactcagaaccttcaacttctgctattcaaagtggtgataattctcaaatt
cctggtctcgatacaactaatgatcaaatcattacacctattgttgcaaaattcaaagca
acaagaaataggcgcattagcttacgagacaagtcaactgaattagagcaattacgtagt
caaagaaatcataagatacctatcagtatgatgtctttatctgtggatgtattaaaactt
attcctgataacagaaaagaaatgaagaaaataattgactattatcattcaatggctact
gttatagtaaagactttaggatcatatgctaaaaagacctgtcaacaaggacgtataaga
agcgatgaagattttaaatatcttgccaaaaaaattaatgaaaatgtgttgttaaaagag
ttacaattaaaaaaagtggacaaattaaaaataagtgacagtacaaaagataaagttgcc
gaatatatcagaaagtatatgtcacggtttggagaagcgtataaaagaaaaccaagtgaa
caaactaatcaccacaaaccgaagtag

DBGET integrated database retrieval system