KEGG   Acyrthosiphon pisum (pea aphid): 100166321Help
Entry
100166321         CDS       T01076                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100166321
Peptidases [BR:api01002]
 Metallo Peptidases
  Family M2
   100166321
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100166321
CD molecules [BR:api04090]
 Proteins
  100166321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
APHIDBASE: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 627 aa AA seqDB search
MNALTTIFVVSATILSAARLARCQADRVDDKFLDPNDYFLAGGDLQDRRRILQDAFNRYS
VQQQQQADQQPRNGFDGIFQQQQRQQQQQQQQQQQGFQRSGRKFTTDEPEQNFETSGRFT
SRTDPRVSPIPTPPIQQGPLTLSNSNIRQLLQQLDVAGSQQCNLNVQAQWDFETNVNEGT
QIRALEQQLLYSEFQRKVFSIMTRLNLDNVIDPNLRRQLKFLSMPGPAALPQEQLSRYNR
LINDMLAVYNSASVCAFDEPLKCGLRLDPDLNMIMSRSRDWNELQHTWIEWRRRTGQKVR
DMFEQLVDVSNQAALLNNVSDASEMWKFPYESPSMRFELEDAWEQIKPLYEQLHAYVRKK
LRDLYGPERISREAPLPAHILGNMWGQSWENILDLTIPYPGKNYLDVTPQMIKQGYTPAA
MFRVAEEFFISLNMSSMPQSFWANSVLEELPGQPIICQPSAWDFCNRQDYRIKMCTQVNM
KDFITVHHEMAHVQYFLNYKKQPKVYRDGANPGFHEALSEAISLSVSTPKHLQTLGLILN
SVDDIPHNINYLFGLAMDKLTFLPFSLALDLWRWDIFKGTTHKERYNCHWWDLRERLGGV
KPPVLRSETDFDPGSKYHVPANIPYIG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccttgacgacgatctttgtcgtttcggcaacgatcctttcggccgctaggctg
gcccgatgccaggccgaccgggtggacgacaagttcttggatcccaacgattattttctg
gccggcggagatctacaagaccgacgtcgcatcctgcaggacgcgttcaacaggtactct
gtgcagcagcaacaacaggcggatcagcaaccgcggaacggtttcgacgggatattccaa
cagcaacagcgacagcagcagcagcaacagcagcagcaacagcaagggttccagcggagt
ggccggaaattcactaccgacgaacccgaacagaatttcgagacttccggtaggttcacg
tcccggaccgatcctcgggtgtcacctataccgacacccccgattcaacagggacctctg
acgctgtccaacagcaacatccggcaattgctgcaacagctcgacgtggccggatcgcaa
cagtgcaacctcaacgtgcaggcgcaatgggatttcgagacaaacgtcaacgagggaacg
caaataagagcgttggagcaacaattgttgtattccgaatttcaacgaaaagtattttcg
ataatgacaagattgaatctggacaatgtcatcgatcccaacctaagaaggcagctcaag
tttttgtcaatgccaggacctgctgcactaccacaagaacaactgagtcgatacaaccgg
ctcataaacgacatgttagctgtttataatagcgcttctgtttgcgctttcgacgaaccg
ttgaaatgtggtctcaggttagacccagatttgaacatgataatgtctcggagtcgagat
tggaacgaactacaacacacttggatagaatggagaagaagaacaggacaaaaagtcaga
gacatgtttgaacagctagtagatgttagcaatcaagcagctttattaaacaatgtatcg
gatgcgtctgaaatgtggaaatttccgtacgaatcaccctcgatgagatttgaattggaa
gacgcttgggaacaaataaaacccttatacgaacaactccatgcctacgtcagaaagaag
ttacgggatctttacgggcccgagagaataagtcgagaagcaccattgcccgcccatatc
ttaggaaacatgtggggtcagtcttgggaaaatattttagacttgaccataccgtatccg
ggaaaaaattatttggatgtcacaccacaaatgatcaaacagggatacacaccagctgca
atgtttagagtggcagaagaatttttcatatcgttaaacatgagttcaatgcctcaatct
ttttgggccaattcagtcttagaggaacttccaggacagcctataatttgtcaaccttct
gcttgggatttttgcaacagacaagattataggattaaaatgtgcacccaagttaatatg
aaagattttatcactgtccatcatgaaatggctcatgtacaatattttttgaattacaaa
aaacaaccaaaagtgtatcgtgatggtgccaatccaggattccacgaagctctaagcgag
gcaatatcgctctctgtgtcaaccccaaagcatttgcaaacgctgggactgatattgaac
tctgttgatgacattccccataacataaactatttgtttggattggcgatggacaagctt
acatttttgccttttagcttggcactcgacttatggcggtgggatatattcaaagggacc
acgcacaaggagagatacaattgtcattggtgggatttacgagaacgacttggcggtgtc
aagcctccagtactccggtccgaaacagatttcgatccgggatcaaaatatcacgtgccc
gccaacattccttacattgggtaa

DBGET integrated database retrieval system