KEGG   Acyrthosiphon pisum (pea aphid): 100169524Help
Entry
100169524         CDS       T01076                                 

Definition
(RefSeq) hexokinase type 2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100169524
   00051 Fructose and mannose metabolism
    100169524
   00052 Galactose metabolism
    100169524
   00500 Starch and sucrose metabolism
    100169524
   00520 Amino sugar and nucleotide sugar metabolism
    100169524
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100169524
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100169524
Membrane trafficking [BR:api04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100169524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
APHIDBASE: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MRTKPEMMGQLRPAFSELNISEGFEFDTELVTNEIKEDCKSLLLSNEQLTTLMKDMDGAI
RNGLGKDTNPSSIVKCYVTYVQDLPNGTERGKFLALDLGGTNFRVLLIELGENNYFHMDS
EIFKVPAHIQTGKGSELFDHIAKCLAEFIKKHNLDNKKALPLGFTFSFPLRQVGLTKGYL
NSWTKGFNCSGVVDEDVVRLLKEAIKRRKDVEIDVCGILNDTTGTIMSCAWKNPNTKIGV
IVGTGCNACYVEKVENAELFDGDKTKPHVIVNTEWGAFGDDGKLDAVRTKYDREIDEDSL
NPGRQRFEKMISGMYMGEIVRLAIVDLANQNKLFEGRLSEQMKTKGAFGTSFVSDIEGDK
ANYKETLKVLSEMGINDPSLVDCANVRYICECVSRRSAHLVSAGLAALLNKMDEKSVTIG
VDGSVYRFHPYFHKLMVEKTKQLTKSDIKFDLMLSEDGSGRGAALVAAVAVRDELPSMTN
GFSAK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccaagccggaaatgatgggccaactgcgtcccgcgttcagcgaactcaatatt
tccgaaggtttcgaattcgacaccgaactcgtcaccaacgagatcaaagaagattgcaaa
tcacttcttttgtccaatgaacaactgaccaccttgatgaaagatatggatggagccatc
aggaatggtttgggcaaagataccaatccatcttccattgtcaagtgttatgtcacttac
gtgcaagatttgcctaatggcacagagagaggaaaattcttggctctggacttgggtggc
accaatttccgtgtgctattgattgaattgggagagaataactacttccatatggactct
gaaatcttcaaagtacctgctcatatccaaactggcaaaggctcagaattattcgatcat
attgctaaatgtctggcagaatttattaaaaaacacaacttggacaacaaaaaggcatta
ccgttgggctttacttttagttttccacttagacaagttggacttaccaaaggatattta
aatagttggactaaaggatttaactgctcaggagtagttgacgaagacgtagtcagactt
ctcaaggaagctatcaagaggagaaaggacgtcgagattgatgtgtgtggaatattgaac
gatacaaccggtacaatcatgtcatgcgcttggaagaacccgaacaccaaaattggagtt
atcgttggaacgggttgcaacgcgtgttacgtggaaaaggtggaaaacgccgaactcttc
gacggtgacaagacgaaaccacacgtgatcgtcaacaccgaatggggtgcattcggagac
gacggaaaattggacgccgtccgcacgaaatacgatcgggaaatcgacgaggactcgttg
aaccccggacgacagagattcgagaaaatgatcagtggcatgtacatgggcgagatcgtg
cggttggccatcgtggacttggccaaccagaacaaactcttcgagggaaggctgtccgaa
caaatgaagaccaagggagcgttcggcacgtcattcgtatccgacattgaaggtgataaa
gccaactacaaagaaaccttgaaggttctgagcgagatgggcatcaacgatccatcattg
gtcgactgcgccaacgtacggtacatctgtgagtgcgtatccaggcggtcggcgcatctg
gtgtccgccggtctggccgctcttctcaacaaaatggacgagaagtccgtcacgatcggt
gttgatggttctgtttaccgtttccatccatacttccataaactcatggtggaaaagact
aaacaactgaccaaatctgacatcaaatttgacctgatgttgtccgaagacggaagtggt
cgtggagcggccctagtcgctgctgtagctgtcagggatgaattaccatcaatgacgaat
ggattctcggcgaaataa

DBGET integrated database retrieval system