KEGG   Anas platyrhynchos (mallard): 101790478Help
Entry
101790478         CDS       T02816                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101790478 (HDAC7)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101790478 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101790478
NCBI-ProteinID: XP_012956876
Ensembl: ENSAPLG00000007048
LinkDB All DBs
Position
Un
AA seq 995 aa AA seqDB search
MDLRIGQRVVKPGSDTALLALKHTQQLQHQLFLASLHQQQVEQLAHQHVRVTMESPHREA
EPGQQEQELRQILNKDKSKRSAVASTVVKQKLAEVILKKQQAAALERTSNPNPSAMPYRS
LEPLDPEGPSPPVLSTFLPPVPSTSLDPPEHFPLRKTASEPNLKVRCKPRKCLTAXDRRK
NPLTRKESAPPSLKRRPPEAIDSSPSSSSTPVSGCSSPNDSLPAEHGALPAASGMAHEAP
LAQRLMLQESSLAQFALQGAASLPAITLGLPATTSARGDADRRPLSGLAHRVPVLNGPVL
AGTHSPMFIPAGLEQHEAGSPLSPRLQPVIILEPSVTHAPLVAVPGLGTVPFSFAPSLIS
AERLSLPGHHKPLGRTRSEPLPQNPKAIQQQLVYQQHHTQFLERLKQQTHLGKRMAKTSE
KPRLRQIPSSEDMEAEGTETGAEGGDQARARVEPARPGSSGKEPERTQKLLQPQEELVLQ
QAYLWDPYQRMQHQLLKRQPLADPPMVPTVLAGHRPLSRAQSSPATATISLPAQDTASKT
LSLPVQEQPTKPHFTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRSQC
ECLRGRKATLEELQCVHTERHVFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGVGVD
SDTIWNELHSSNAARWAAGSVTELAFKVATRELKNGFAVVRPPGHHADPSTAMGFCFFNS
VAIAARQLQQKGKLSKILIVDWDVHHGNGTQQVFYRDPDVLYISLHRHDDGNFFPGSGAA
DEVGAGPGEGFNVNVAWTGGLDPPMGDPEYLAAFRTVVMPIAHEFSPDVVLVSAGFDAAX
XXXXXXXGHPPPLGGYKVSAKCFGYMTKQLMSLAGGAIVLALEGGHDLTAICDASEACVS
ALLGNELDPLPEESMRQKPNANAVRSLEAVIQVQSKYWVAVQRFASKLGCSFLEAQHHEA
EEVETVTALASLSVAVMVEKRPQDEPMEEEEPMNQ
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcatcgggcagcgcgtcgtcaagcccggctccgacaccgccctgctggcc
ctgaagcacacgcagcagctgcagcaccagctcttcctcgccagcctgcaccagcagcaa
gtggagcagctcgcccaccagcacgtgagggtgaccatggagtccccgcatcgcgaggca
gagcccgggcagcaggagcaggagctgcggcagatcctcaataaggacaagagcaaacga
agtgctgtggccagcacggtggtgaagcagaaactggcggaggtcatcctgaagaagcag
caggcagcagctttggaaaggaccagcaaccccaacccttctgccatgccgtacaggtct
ttggagcctctggatcctgagggcccttcccctcctgtactcagcaccttcttgcccccg
gtccctagcacttctcttgaccccccggagcattttccactgcggaaaacagcgtccgag
cccaacctgaaggtgcgttgcaagcccaggaagtgcctgaccgccntggaccgccgcaag
aaccccctgacccgcaaggagagcgcgcccccctcgctgaagaggaggccgcccgaggcg
atcgattcctccccaagcagcagcagcacccccgtgtctggctgcagctctcccaacgac
agcctccccgccgagcacggagccctccccgccgcctccggcatggcccacgaggcgccc
ctggcccagcgcctgatgctgcaggagagctccctggcccagtttgccttgcagggcgca
gcctcccttcctgccatcacgctgggattgccggccaccactagcgccaggggagacgcg
gatcgccgccccctctccggcctggcccaccgggtgcccgtgctgaacgggcccgtcctc
gcaggcacgcactcgcccatgttcataccagctggcttggagcagcacgaggccgggagc
cccttgtcccctcggctgcagcccgtcatcatcctcgagccctcagtcactcacgctccg
cttgtggctgtgccagggctgggaacggtccccttctccttcgccccctcgctcatctcc
gcagagcgcctgtcgctcccgggccaccacaagcctctgggcaggacccgctcggagccc
ctgccccaaaaccccaaggccatccagcagcaactggtgtaccagcagcatcacacccag
ttcctggagaggctcaagcagcagacacatctgggcaagcgcatggccaaaaccagcgag
aagccccggctgcggcagatcccctcctcggaggacatggaagcagaagggacggagacg
ggggctgagggcggcgaccaggcgagggcacgtgtggagcctgcgaggccggggagcagc
gggaaggagcccgagaggacgcagaagctgctgcagcctcaggaggagctcgtcctccag
caggcgtatctctgggacccctaccagcgcatgcagcaccagctcctcaagcggcagcct
ctggccgacccccccatggttccgaccgtcctcgcggggcacaggcccctctccagggct
cagtcatctcctgccaccgccaccatctccctccctgcccaggacacggcctccaagacg
ctctccctgcccgtgcaggagcagccgaccaagcctcacttcacgacagggctggtttac
gactcggtgatgctcaagcaccagtgctcctgcggagacaacagcaaccacccagagcac
gcgggcaggattcagagcatctggtcccggctgcaggagcgggggctgcgcagccagtgc
gagtgtctgcggggacgcaaggccaccctggaggagctgcagtgcgtccacaccgagcgc
cacgtcttcctctacggcaccaatcccctcaaccgcctgaaactggacaacgggaagctg
gcagggatcctgtcgcagcggatgttcgtcatgctgccctgcggaggggtgggggtggac
agcgataccatctggaacgagctgcactcctccaacgccgcccgctgggccgcgggcagc
gtcaccgagctggccttcaaggtggccaccagggagctgaagaacggtttcgctgtggtg
aggccgcccggacatcacgcggatccatccactgccatggggttctgcttcttcaactcc
gtggccatcgctgccaggcagctgcagcagaaagggaaactcagcaagatcctcatcgtg
gactgggatgttcaccatggcaatgggacccagcaggtcttctacagggaccccgacgtt
ctctacatctccttgcaccgtcacgatgatgggaacttcttccccggcagcggggccgcc
gacgaggttggtgctggccccggtgagggatttaacgtcaacgtagcctggactggaggg
ctcgacccccccatgggtgaccctgagtatctggcagctttcaggacggtggtgatgcca
attgcacatgaattctcccccgacgtggtgctggtgtcggccggcttcgacgcagcnnnn
nnnnnnnnnnnnnnnnnnnatggccacccaccacccctgggtggctacaaagtctctgct
aaatgctttggctacatgacaaagcagctgatgagcctggcagggggagccatcgtcctc
gctctggagggtggccacgacctcacggccatctgcgatgcgtccgaggcctgcgtgtca
gccttgctgggcaacgagctggaccctctcccagaagagagcatgaggcagaaacccaat
gccaacgccgtgcgctccttggaggcggtgatccaggtccagagtaaatactgggtggcc
gtgcagcgttttgcctccaagctgggctgctccttcctggaggcgcagcaccacgaggca
gaagaagtggagaccgtcacagccttggcctccctctcggtggccgtgatggtggagaag
aggccccaggacgagccgatggaggaagaggagcccatgaaccagtga

DBGET integrated database retrieval system