KEGG   Anas platyrhynchos (mallard): 101792988Help
Entry
101792988         CDS       T02816                                 

Gene name
trypsin-I
Definition
(RefSeq) trypsin I-P1
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:apla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101792988 (trypsin-I)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101792988 (trypsin-I)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101792988 (trypsin-I)
Peptidases [BR:apla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101792988 (trypsin-I)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101792988 (trypsin-I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKYILFVAFVGVAVAFPISDDDDDKIVGGYTCTKNSIPYQVSLNSGYHFCGGSLISSQWV
LSAAHCYKSSIQVKLGEHNLASQEGTEQTISSSKVIRHSGYNAYTLDNDIMLIKLSKAAT
LNSYVNTVPLPTSCVATGTTCLISGWGNTLSSGSLYPDNLQCLRAPVLSSSQCSSAYPGQ
ITSNMICVGYLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYVSW
IQSTIAAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatactgtttgtcgcctttgttggtgtggctgttgccttccccatcagtgat
gatgatgatgacaagattgtgggaggctacacctgtacaaagaactctattccatatcag
gtgtccctgaattctgggtatcacttctgtggaggttctctcatcagcagccagtgggtc
ctgtcagcggctcactgctacaagtcttccatccaagtgaaacttggggaacacaacctg
gcatcccaagaaggcactgagcagaccataagttcatctaaagtcatccgccactctggc
tacaacgcctacacgctggacaacgacattatgctcatcaaactttccaaagcagccaca
ctcaactcctatgtcaacacagttcctcttcctaccagctgtgtggccactggcaccaca
tgcctaatctctggatggggcaacacactcagcagtggcagtctgtatccagataacttg
cagtgcctgagagctcctgtactctcctcaagccagtgcagcagtgcctaccccggccaa
attactagcaacatgatatgtgtaggatacctggaaggagggaaagactcctgccagggg
gattctggtggtccagtagtctgcaatgggcaactccaaggtattgtttcctggggcatt
ggatgtgcacagaaaggctatcctggagtttacactaaggtttgcaattatgtctcctgg
atccaatcaactattgctgccaactga

DBGET integrated database retrieval system