KEGG   Anas platyrhynchos (mallard): 101793933Help
Entry
101793933         CDS       T02816                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101793933 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101793933 (SDHB)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101793933 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 258 aa AA seqDB search
MQICRGAQTAAAAAPRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNE
LDSTLTFRRSCREGICGSCAMNIAGGNTLACTKRIDPDLGKITKIYPLPHMYVVKDLVPD
LSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWN
GDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKA
IAEIKKMMATYKEKAAAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctgtcggggagcacagacagctgctgcggccgcgccacgcatcaagaagttt
tccatctacagatgggatcccgataagcctggggacaagccccgcatgcagacgtacgag
gtggatttgaataaatgtgggcccatggtactcgatgctctgatcaagattaaaaacgag
ttggactccactctgaccttccgcaggtcatgcagggaaggcatctgtggctcttgtgct
atgaacattgctggtggaaacaccctggcctgcaccaaaagaattgaccctgatctgggc
aagatcactaaaatctaccctctcccccacatgtatgtggtgaaggatcttgttccggac
ttgagtaacttctatgcacagtataaatccattgagccttacctgaagaagaaggatgag
tcgaaacagggcaaggagcagtacctgcagtccatagaagaccgtcagaaactggacgga
ctctacgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagttactggtggaac
ggggacaagtacttgggtcctgcggtactgatgcaggcctatcgctggatgattgactcc
agggatgactacacagaggaacgcctggcacaacttcaagacccgttttctctctaccgt
tgtcacactatcatgaattgcacaagaacttgcccaaagggtttgaaccctggcaaagca
attgctgagatcaagaagatgatggcaacttacaaagagaaggcagccgctgcgtaa

DBGET integrated database retrieval system