KEGG   Anas platyrhynchos (mallard): 101794928Help
Entry
101794928         CDS       T02816                                 

Gene name
SOD2, SODMn
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:apla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101794928 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101794928 (SOD2)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101794928 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 231 aa AA seqDB search
SAKTPSNAASFCLFSSRSGAKLVAPLGCLVPRQKHTLPDLPYDYGALEPHINAEIMQLHH
SKHHAAYVNNLNVAEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGG
EPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPLQ
GTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYASCKK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
agcgctaaaacaccgagtaacgctgcttccttctgccttttctcttccagaagcggggcc
aagctggtagcccccctggggtgcctggtgcccaggcagaagcacaccctcccggacctg
ccctacgactatggcgctctggagccccacatcaacgccgagatcatgcagctgcaccac
agcaagcaccacgccgcatatgtcaacaacctgaacgtggcggaggagaagtacaaggag
gcgctggcaaaaggtgatgttacagctcaggtgtcacttcagcctgcactgaagttcaat
ggtgggggtcatatcaatcacaccatcttctggacaaatctttcgcctaatggaggagga
gagcctaaaggagaactgatggaagccatcaagcgtgactttggttcctttgcaaacttc
aaggagaagctaacagctgtatcagttggtgttcaaggatcaggctgggggtggcttggc
tataacaaagagcaagggcgcctgcagatagcagcttgtgcaaatcaagaccctttgcaa
ggaacaacaggtcttattcctttgctaggaatcgatgtatgggaacatgcctattacctt
cagtataaaaatgttcgacctgattatttgaaagccatctggaatgtgatcaactgggag
aatgtatcttcaagatatgcatcatgcaaaaagtag

DBGET integrated database retrieval system